KEGG   Propionibacterium acnes SK137: HMPREF0675_5343Help
Entry
HMPREF0675_5343   CDS       T01215                                 

Gene name
ald_1
Definition
alanine dehydrogenase (EC:1.4.1.1)
Orthology
K00259  
alanine dehydrogenase [EC:1.4.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pak00250]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:pak00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2390908..2392029)
Genome map
AA seq 373 aa AA seqDB search
MCVMRVGVPTEVKNSEFRVAVTPAGVHALVGRGHEVLVQAGAGVGSGIPNSDFVGAGARV
VGDVESVWGDADLVLKVKEPVAEEYGRLHEGLVLFTYLHLAADEALTRELLGRGVTSIAY
ETVELADHSLPLLSPMSEIAGRLAAQVGANCLLQSAGGRGVLFGGGSGVRRGRVSVLGGG
VAGLCAARVAAGMGADVTVFDVDVARMRYIDEVWGGRIGTRFSSPLAVREACGESDVVIG
SVLVPGARTPHLVDHEMVLGMVPGSVLVDVAVDQGGCFEDSHPTTHADPTFVVGGSVFYC
VANMPGAVPHTSTYALTNATMRYVLLLADEGWRGACGSRDDLRRGLATCGGKLVSAPVGE
ALGIECVPVSEVL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgtgatgcgtgttggtgttcctactgaggttaagaatagtgagtttcgtgtggct
gtgacgccggcgggtgttcatgcgttggttggtcgtggtcatgaggtgttggttcaggct
ggtgctggtgtgggttcgggtattccgaattcggattttgtgggtgctggtgcgcgggtt
gtgggtgatgtggagtcggtgtggggtgatgctgatttggtgttgaaggtgaaggagcct
gttgcggaggagtatgggcggttgcatgagggtttggttctttttacgtatcttcatttg
gctgctgatgaggcgttgactcgtgagcttttggggcgtggggtgacgtcgattgcgtat
gagacggtggagttggctgatcattcgttgccgttgttgtctccgatgtcggagattgcg
ggtcggttggctgctcaggtgggtgcgaattgtttgttgcagtctgctgggggtcgtggt
gtgttgtttggtggtggttcgggtgtgcgtcgtggtcgggtgagtgtgcttggtggtggt
gtggctgggttgtgtgcggctcgtgtggctgcgggtatgggtgctgatgtgacggtgttt
gatgtggatgtggcgcggatgcgttatatcgatgaggtgtggggtgggcgtattggtacg
cggttttcgagtccgttggcggttcgggaggcgtgtggtgagtctgatgtggtgattggg
tcggtgttggtgcctggtgctcggactccgcatttggtggatcatgagatggtgttgggg
atggtgccggggtcggtgttggtggatgttgcggtggatcagggtgggtgttttgaggat
tctcatccgacgacgcatgcggatccgacgtttgtggtggggggttcggtgttttattgt
gtggcgaatatgccgggtgcggtgccgcatacgtcgacgtatgcgttgacgaatgcgacg
atgcggtatgtgttgttgttggctgatgagggttggaggggtgcgtgtgggtcgcgtgat
gatttgcggcgtggtttggcgacttgtggtgggaagttggtgagtgcgccggtgggtgag
gcgttgggtattgagtgtgtgcctgtgtctgaggtgttgtga

DBGET integrated database retrieval system