KEGG   Propionibacterium acnes SK137: HMPREF0675_5343Help
Entry
HMPREF0675_5343   CDS       T01215                                 

Gene name
ald_1
Definition
alanine dehydrogenase (EC:1.4.1.1)
Orthology
K00259  
alanine dehydrogenase [EC:1.4.1.1]
Organism
pak  Propionibacterium acnes SK137
Pathway
Alanine, aspartate and glutamate metabolism
Taurine and hypotaurine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pak00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF0675_5343 (ald_1)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    HMPREF0675_5343 (ald_1)
Enzymes [BR:pak01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.1  alanine dehydrogenase
     HMPREF0675_5343 (ald_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2390908..2392029)
Genome map
AA seq 373 aa AA seqDB search
MCVMRVGVPTEVKNSEFRVAVTPAGVHALVGRGHEVLVQAGAGVGSGIPNSDFVGAGARV
VGDVESVWGDADLVLKVKEPVAEEYGRLHEGLVLFTYLHLAADEALTRELLGRGVTSIAY
ETVELADHSLPLLSPMSEIAGRLAAQVGANCLLQSAGGRGVLFGGGSGVRRGRVSVLGGG
VAGLCAARVAAGMGADVTVFDVDVARMRYIDEVWGGRIGTRFSSPLAVREACGESDVVIG
SVLVPGARTPHLVDHEMVLGMVPGSVLVDVAVDQGGCFEDSHPTTHADPTFVVGGSVFYC
VANMPGAVPHTSTYALTNATMRYVLLLADEGWRGACGSRDDLRRGLATCGGKLVSAPVGE
ALGIECVPVSEVL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgtgatgcgtgttggtgttcctactgaggttaagaatagtgagtttcgtgtggct
gtgacgccggcgggtgttcatgcgttggttggtcgtggtcatgaggtgttggttcaggct
ggtgctggtgtgggttcgggtattccgaattcggattttgtgggtgctggtgcgcgggtt
gtgggtgatgtggagtcggtgtggggtgatgctgatttggtgttgaaggtgaaggagcct
gttgcggaggagtatgggcggttgcatgagggtttggttctttttacgtatcttcatttg
gctgctgatgaggcgttgactcgtgagcttttggggcgtggggtgacgtcgattgcgtat
gagacggtggagttggctgatcattcgttgccgttgttgtctccgatgtcggagattgcg
ggtcggttggctgctcaggtgggtgcgaattgtttgttgcagtctgctgggggtcgtggt
gtgttgtttggtggtggttcgggtgtgcgtcgtggtcgggtgagtgtgcttggtggtggt
gtggctgggttgtgtgcggctcgtgtggctgcgggtatgggtgctgatgtgacggtgttt
gatgtggatgtggcgcggatgcgttatatcgatgaggtgtggggtgggcgtattggtacg
cggttttcgagtccgttggcggttcgggaggcgtgtggtgagtctgatgtggtgattggg
tcggtgttggtgcctggtgctcggactccgcatttggtggatcatgagatggtgttgggg
atggtgccggggtcggtgttggtggatgttgcggtggatcagggtgggtgttttgaggat
tctcatccgacgacgcatgcggatccgacgtttgtggtggggggttcggtgttttattgt
gtggcgaatatgccgggtgcggtgccgcatacgtcgacgtatgcgttgacgaatgcgacg
atgcggtatgtgttgttgttggctgatgagggttggaggggtgcgtgtgggtcgcgtgat
gatttgcggcgtggtttggcgacttgtggtgggaagttggtgagtgcgccggtgggtgag
gcgttgggtattgagtgtgtgcctgtgtctgaggtgttgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system