KEGG   Candidatus Phytoplasma australiense: PAa_0085Help
Entry
PAa_0085          CDS       T00752                                 

Gene name
folA
Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pal  Candidatus Phytoplasma australiense
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PAa_0085 (folA)
   00670 One carbon pool by folate
    PAa_0085 (folA)
Enzymes [BR:pal01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PAa_0085 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
93356..93853
Genome map
AA seq 165 aa AA seqDB search
MINLITAFDSNYLIGSDNKLPWHYPQDLHFFKKTTLNQEVLMGHQTYLSLKSYFKDKPFN
FKKTYVAARNKGLQLDGCEVVFDLLTFLKTFLIQKKSHLFVIGGRQIYQQSLPFVDNLYI
TYILNRHKGNVYFPPVNWQDFQLIQKTIQPQLIFAFYKRKKDPLC
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttaatcacagcttttgatagtaattatctaataggaagcgataataaactt
ccttggcattatcctcaagatttgcatttttttaaaaaaacaactttgaatcaagaagtt
ttaatgggtcatcaaacttatctttcgttaaaaagttatttcaaagacaagccttttaat
tttaaaaaaacttatgttgccgctcgaaataaaggtttgcaattggatggttgtgaagtg
gtttttgatttgttaacttttttaaaaacttttttaattcagaaaaaatcgcatcttttt
gttattggaggtagacaaatttatcaacaaagtttgccgtttgtggataatttatatatt
acttatattttaaatagacataaagggaatgtttattttcctccagtcaattggcaagat
tttcaattaattcaaaaaacgattcaacctcaattaatttttgctttttataaaaggaaa
aaggatccattatgttaa

DBGET integrated database retrieval system