KEGG   Candidatus Phytoplasma australiense: PAa_0105Help
Entry
PAa_0105          CDS       T00752                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pal  Candidatus Phytoplasma australiense
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pal00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115074..115712
Genome map
AA seq 212 aa AA seqDB search
MKLNQKGLLIVLSGPSGVGKATVRKALFEMKNHNFVYSISSTTRKPRLGEQEGKDYYFLT
KEEFELGIKNNKFLEWAKFIDNYYGTSRKQVEDYLKEGKEVFLEIEVEGATQLRKKKFRN
AVFIFLVPPEKKVLYERLKKRGTESADKIQQRIMKADKEFPLAHKYDYIVVNDDVFNAAD
RIIAIIRAEHAKTKRSIRNYLKILENDGYAEQ
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaaccaaaaagggcttttaatagttctttcaggcccttctggcgttggcaaa
gcaacagttagaaaagctttatttgaaatgaaaaatcataattttgtttattctatttca
tcaacaacaagaaaacctagattaggcgaacaagaaggaaaagactattattttctcact
aaagaagaatttgaattaggaatcaaaaataacaaatttttagaatgggctaaatttatt
gataattattatggtacttctcgtaaacaagtggaagattacctaaaagaaggcaaagaa
gtttttttagaaatcgaagtagaaggggcaacccaattaagaaaaaaaaagtttcgtaat
gcagttttcatttttttagttcctcctgaaaaaaaagtcctttatgaaaggttgaaaaaa
aggggaacagaatcagccgacaaaatacaacaacgtattatgaaagctgataaagaattc
cctttagctcataaatatgattatattgttgttaatgatgatgttttcaatgccgctgat
cggattattgcaattattagagcggaacatgcaaaaactaaacgtagtattcgtaattat
ttaaagattttggagaatgatggttatgccgaacaataa

DBGET integrated database retrieval system