KEGG   Candidatus Phytoplasma australiense: PAa_0164Help
Entry
PAa_0164          CDS       T00752                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pal  Candidatus Phytoplasma australiense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAa_0164 (pfkA)
   01230 Biosynthesis of amino acids
    PAa_0164 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAa_0164 (pfkA)
   00030 Pentose phosphate pathway
    PAa_0164 (pfkA)
   00051 Fructose and mannose metabolism
    PAa_0164 (pfkA)
   00052 Galactose metabolism
    PAa_0164 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PAa_0164 (pfkA)
Enzymes [BR:pal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAa_0164 (pfkA)
Protein phosphatases and associated proteins [BR:pal01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAa_0164 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194757..195731
Genome map
AA seq 324 aa AA seqDB search
MKKEKELKKIAVLTSGGDAPGMNAAIRAVVLEGNKQGFEVYGVKDGYLGLYNNEISLLDS
NYFPRVINVSGTFLGTSRFLPFQNDLAVRQTCANNLKKLGVEKLVVIGGDGSYKGAMKLK
ELGIKCVGLPATIDNDINNTDFTIGFSTALNNIVDAIEKLRDTSISHHRCSIIEVMGRYK
GDLALYGGLAAASDVIVTRENLLSKQEILDKVKVLYQAKKRHAIVVVTEHIFDVATLAKE
VEKYSGFETRAQVLGHIQRGGRPTAEDLVLAFRMGSYAVSLLQQNIFDCAVGTCGLNLNY
THFFDVFNNHNQQNDLFHAIAKLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaaaagaattaaaaaaaattgctgttttaacttcaggaggagatgctcct
ggtatgaatgctgccattagagcagttgttttagaaggaaataaacaaggttttgaagtt
tatggagttaaagatggttatttaggtttgtataataacgaaataagtcttttagattca
aattatttcccccgcgttattaatgtttcaggaacttttttgggaacttctcgttttctc
ccttttcaaaacgaccttgctgttcgccaaacttgtgcaaacaatttgaaaaaattggga
gttgaaaaattagttgttatcggtggtgacggttcttataaaggcgctatgaaattaaaa
gaattaggaattaaatgtgttggcttgcctgctactattgataatgatattaataatacc
gattttacaattggttttagtactgctttgaataacattgtggatgcaattgaaaaatta
cgcgatacttctatttctcatcatagatgtagtatcattgaagttatgggacgctacaaa
ggagatttagctttatacggaggacttgcagccgcttcagatgttattgtaactcgcgaa
aatcttttatctaaacaagaaattttagacaaagttaaagttttatatcaagctaaaaaa
agacatgctattgtagttgtgacagaacatatctttgatgttgcaacccttgctaaggaa
gttgaaaaatatagcggatttgaaactcgcgcccaagttttaggtcatattcaaagaggc
ggaagacctactgcagaagacttagtgcttgcttttagaatgggaagttatgcggtttct
ttgttacaacaaaatatttttgattgtgctgttggtacttgtggtcttaatttaaattat
acacatttttttgatgtttttaataaccataaccaacaaaatgatttatttcatgcaatt
gctaaattattataa

DBGET integrated database retrieval system