KEGG   Candidatus Phytoplasma australiense: PAa_0221Help
Entry
PAa_0221          CDS       T00752                                 

Gene name
gtfA
Definition
Sucrose phosphorylase (Glucosyltransferase-A) (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pal  Candidatus Phytoplasma australiense
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:pal00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAa_0221 (gtfA)
Enzymes [BR:pal01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     PAa_0221 (gtfA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260515..261975
Genome map
AA seq 486 aa AA seqDB search
MKIKNKVMLITYPDSLGKNISDLIKVLKEDIGNDVIGGVHLLPFFPSTSDRGFAPSDYNL
VDPAFGDWKDIEELGKQYYLMFDFMINHISRASVMYQDFKKNHELSKYSNFFIRWENFWL
KAGQNRPTQEDIDLIYKRKDKEPNQLIKFDNGQKEHLWNTFGEDQIDININDDIAKEFIK
KTLEFMVKKGASLIRLDAFAYVCKKAGTNCFFLEPEIWDLLHGVSEILKPLGACILPEIH
EQYSISHKISEQGYFIYDFALPLVVLFTMYSGKTHRLKEWLAKSPMKQFTTLDTHDGIGV
VDALDILTEDEINYTSKRIYKIGVNAKKIYSTKAYKNLDIYQINSTYYSALGNEDDTYLL
SRAFQIFAPGIPQIYYVGLLAGENDIKLLEATKEGRNINRHYYSREEIKAEVKRQVVVDL
FKLLKWRNECQAFDLDGSIFVDPTLENHKIKILRQDKSGQNKAVLEADVVSKKFIITHNG
KEIFKN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaataaagtaatgttgatcacttatcctgattcattgggaaaaaacatt
tcagatttaattaaagttttaaaagaagatattggcaacgatgttattggaggagttcat
cttttgccttttttcccctccacaagtgaccgcggctttgcaccttctgattataattta
gttgatcctgcttttggagattggaaagatatagaagaattaggtaaacaatattattta
atgtttgattttatgattaatcatatttcacgtgcatctgtcatgtatcaagatttcaaa
aagaatcatgaattatccaaatatagtaatttttttattcgttgggaaaatttttggtta
aaagcaggtcaaaacagacctacacaagaagatattgatttgatttataaacgaaaggac
aaagaacccaaccaacttattaagtttgataacggccaaaaagaacacctttggaacact
tttggcgaagatcaaattgatatcaacatcaatgatgatattgccaaagaatttattaaa
aaaactttagaatttatggtgaaaaaaggggctagtttaattcgtttagatgcatttgct
tatgtttgtaaaaaagctggtacaaattgttttttcttagaacctgaaatatgggatttg
ttacatggagtaagcgagattttaaaacctttaggagcttgtatattgccagaaattcat
gaacaatattctatttctcataaaataagcgaacaaggatattttatttatgatttcgcg
cttcctttggtagtcctttttacgatgtattcaggaaaaacacatcgcttgaaagaatgg
cttgcaaaatctcccatgaaacaattcactaccctagatactcacgacggcattggggtt
gttgatgcacttgatattcttacagaagatgaaattaattatacctctaaaagaatatat
aaaattggtgttaatgctaaaaaaatttattccactaaagcatacaaaaacctagatatt
tatcaaatcaattcaacttattattcagccttaggcaatgaagatgacacttatttatta
agtcgtgcttttcaaatttttgctcctggcattcctcaaatttattatgttggtcttttg
gcaggagaaaacgatattaaattattagaggcgactaaagaaggcagaaacatcaaccgt
cattattattctcgcgaagaaatcaaagcagaagtcaaaaggcaagttgtagttgattta
tttaaattattaaagtggcgcaatgaatgtcaagcctttgatttagatggaagtattttt
gttgatcctactttagaaaatcataagatcaaaatcttacgtcaagataaaagcggtcaa
aataaagctgttttagaagcggatgttgttagcaaaaaatttattattactcacaacggc
aaagaaatatttaaaaattaa

DBGET integrated database retrieval system