KEGG   Candidatus Phytoplasma australiense: PAa_0514Help
Entry
PAa_0514          CDS       T00752                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pal  Candidatus Phytoplasma australiense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PAa_0514 (tpiA)
   01230 Biosynthesis of amino acids
    PAa_0514 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAa_0514 (tpiA)
   00051 Fructose and mannose metabolism
    PAa_0514 (tpiA)
   00562 Inositol phosphate metabolism
    PAa_0514 (tpiA)
Enzymes [BR:pal01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PAa_0514 (tpiA)
Exosome [BR:pal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PAa_0514 (tpiA)
  Exosomal proteins of bladder cancer cells
   PAa_0514 (tpiA)
  Exosomal proteins of melanoma cells
   PAa_0514 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(507657..508463)
Genome map
AA seq 268 aa AA seqDB search
MNNLKRIKVIAGNWKMYKDKNEALEFIQKVNFSIPNSKEVETIIFAQSTLLDVLVQNQGP
NLKIGAQNAFHESEGAFTGEISPLNLVSLGVKYVLLGHSERRVLFGETDQLVNLKLLKAL
QNNLSPVLCLGETLETKENNKTKEFLEKQLTQALKDVPQEDLEKILIAYEPVWAIGTGKT
ASPQEANQTIKQIREKVTNLYSAQVVQSLKILYGGSVSSNNVEAILEQNEIDGVLVGKAS
LETKDFLNFTQAAVKLSSNCCQHFDKKC
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatcttaaaagaattaaagttatcgcgggaaattggaaaatgtataaagataaa
aatgaagctttagaatttattcaaaaagttaatttttccattccaaactcaaaagaagtt
gaaacaattatttttgctcaaagtactttattagatgttttggttcaaaaccaaggacct
aaccttaaaattggtgctcaaaacgcttttcatgaaagcgagggagcttttactggagaa
atttcgcctcttaatttagtttctttaggagttaaatatgttttgttagggcatagcgaa
agaagagttctttttggagaaaccgatcaattagttaatttaaaattattaaaagcgctt
caaaataatttatctccagttttatgtttgggtgaaactcttgaaacaaaagaaaataac
aaaacaaaagaatttttagaaaaacaattaacacaagctttaaaagatgttccacaagaa
gatttagaaaagattcttattgcttatgaacctgtttgggcaatcggaacaggaaaaacc
gcttcccctcaagaagctaatcaaactatcaaacaaattagggaaaaagtcacaaattta
tattcagctcaagtggtgcaaagtttaaaaattctttatggtggctctgtttcttctaat
aacgttgaggctattttagaacaaaatgagattgatggcgttttagttggcaaagcttct
ttagaaactaaagattttttaaattttactcaagcagctgttaaattatcaagcaattgt
tgtcaacatttcgataaaaaatgttag

DBGET integrated database retrieval system