KEGG   Pteropus alecto (black flying fox): 102880502Help
Entry
102880502         CDS       T02993                                 

Gene name
RBKS
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102880502 (RBKS)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102880502 (RBKS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 322 aa AA seqDB search
MAASGEPGRQWQEEVAAVVVVGSCMTDLVSLTSRLPKTGETIHGHKFFIGFGGKGANQCV
QAARLGAKTSMVCKVGKDSFGNDYIENLKQNDISTEFTYQTKDAATGTASIIVNKEGQNI
IVIVAGANLLLNTEDLRKAAKAISRARVMICQLEVTAATSLEALTMAHRSGVKTLFNPAP
ATADLDPRFYALSDVFCCNESEAEILTGLAVSSPAAAGKAALVLMQRGCRVVIVTLGAEG
CVMLSQTEPVPKHIPTEKVKAVDTTGAGDSFVGALAFYLAYYPNLSLEEMLKRSNFIAAV
SVQATGTQSSYPYKKDLPLDLF
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgtctggggaacccgggaggcagtggcaggaggaggtagccgcggtggtagtg
gtgggctcctgcatgaccgacctggtcagtcttacttctcgtttgccaaaaactggagaa
accatccatggacataaattttttattggctttggagggaaaggtgccaaccagtgtgtc
caagctgctcggcttggagcgaagacatccatggtgtgcaaggttggcaaagattctttt
ggcaatgattatatagaaaacttaaaacagaatgatatttctacagaatttacatatcag
actaaagatgctgctacaggaactgcttctataattgtcaataaagaaggccagaatatc
atcgttatagtggctggagcaaatttacttctgaatactgaagacctgaggaaagccgcc
aaggccatcagcagagccagagtaatgatctgccagctggaagtgactgcagcaacttct
ctggaagccctaacaatggctcaccgcagtggagtgaaaacgttgttcaatccggctcct
gctactgctgacctggacccccgcttctacgctctctcagatgtgttctgctgcaatgaa
agtgaggctgagattctgacgggcctcgcagtcagcagccctgcggctgctgggaaggct
gcgctggtgctcatgcaaaggggctgccgggtcgtaatcgtcaccttaggtgccgaagga
tgtgtgatgctgtcacagacagagcccgttccgaagcacattcccacagagaaagtcaag
gctgtggataccacgggcgctggtgacagttttgtgggagctttggccttctacctggct
tactacccaaatctgtccttggaagaaatgctgaagagatccaatttcatcgcagcagtc
agtgtccaggctacaggaacacagtcatcttatccatacaaaaaagacctgccacttgat
ctgttttga

DBGET integrated database retrieval system