KEGG   Pteropus alecto (black flying fox): 102880919Help
Entry
102880919         CDS       T02993                                 

Gene name
F13A1
Definition
coagulation factor XIII, A1 polypeptide
Orthology
K03917  
coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:pale00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    102880919 (F13A1)
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102880919 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 732 aa AA seqDB search
MSGTPGTTFGGRRAVPPNNSNAAENELSTVELQSLVPRGFNPQDYLNVTGVHLFKERWDT
NKIDHHTDKYDSNKLIVRRGQSFYIQIDFNRPYEPRRDLFRVEYVIGRYPQENKGTYVPV
PIVSELQRGKWGAKVVTRDDRSVRLSIQSSPKCIVGKFRMYIAVWTPYGIIRTSRNPETD
TYILFNPWCEEDAVYLDDDKEREEYVLNDIGVIFYGDFNNIKSRSWSYGQFEDGILDACL
YMMDRAQMDLSGRGNPIKVSRVGSAMVNSKDDEGVLVGSWDNIYAYGVPPSAWTGSIDIL
LEYQSSQNPVRYGQCWVFAGVFNTFLRCLGIPARVVTNYFSAHDNDANLQMDIFLEEDGN
VNSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAIKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVEAVDTTHIGKLIVTKQIGGDDMKDITD
TYKFQEGQKEERLALETALMYGVKKPLNTESVIKPKSDVVMDFEVENAVLGKDFKVNITF
QNNSPNSHTISAYLSGNITFYTGVSKEEFKKETFDVTLEPLSIKEEEVLVRAGEYMGQLL
EQASLQFFVTARVDKTGDILAKQKSTVLTIPKVNIKVRGPKMVGSDMVVTVEFTNPLKET
LQNVWIHLDGPGVIKPKRKLFREIQPNSTVQWEEVCRPWVSGHRKLIASMTSDSLRHVYG
ELDLQIQRQPSM
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggacccctggaaccacctttggaggcaggagagctgtcccccccaacaactcc
aatgcagcagagaatgaactctctactgtggagctgcagagcctggtgccccggggcttc
aacccgcaagactaccttaatgtcacgggtgttcacctgttcaaggagagatgggatacc
aacaaaatagatcatcacactgacaagtatgatagcaacaaacttattgtacgtagagga
cagtctttctacatccagatcgacttcaatcgtccatacgaacccagaagagatctcttc
agggtggaatatgtcattggtcgctaccctcaggagaacaagggaacctacgtcccagtt
cctatcgtttcggaactgcaaaggggcaagtggggggccaaagttgtcacgagagacgac
aggtctgtccggctgtctatccagtcttcgcccaagtgcattgtgggaaaattccgcatg
tacattgccgtctggaccccctacggaataatccgcaccagccgaaacccagaaacagac
acgtacattctcttcaatccttggtgtgaagaggatgctgtgtacctggatgatgataaa
gaaagagaagaatatgtcctgaatgacatcggggttattttttatggagacttcaataac
atcaaaagtagaagctggagctatggtcagtttgaggatggcatcctggacgcttgcctg
tatatgatggacagagcacaaatggacctttcaggtagagggaatcccatcaaagtcagc
cgcgttggctctgcaatggttaattccaaagatgatgaaggtgtcctcgttggatcttgg
gacaatatctatgcctatggtgtccctccatcagcctggactggaagcattgacattctg
ttggaataccagagttctcagaacccagtccggtatggacagtgctgggtttttgctggt
gtctttaacacatttttacgatgccttgggataccagcaagagttgttaccaattatttc
tcagcccatgataatgatgccaatttacaaatggacatcttcctggaagaagatgggaac
gtgaactccaaactcaccaaggattcagtgtggaactaccattgctggaatgaagcctgg
atgacaaggcctgatcttcctgttggatttggtggttggcaagccgtggacagtactccg
caggaaaacagtgatggaatgtatcggtgtggcccagcctctgttcaagccattaagcat
ggtcatgtttgcttccagtttgatgcacccttcgtttttgcagaggtcaacagtgatctt
gtttacattacagctaaaaaagatggcactcatgttgtggaagctgttgacaccacccac
attgggaaattaattgtgaccaaacaaattggaggagatgacatgaaggatattactgat
acctacaaattccaagaaggccaaaaagaagagagactggcccttgaaactgccctgatg
tatggggttaaaaagcccctcaacacagaaagtgtcatcaaaccaaagtctgatgtggtc
atggactttgaagtggaaaatgccgtgctgggaaaagacttcaaggtcaacatcaccttc
cagaacaacagccccaactctcacactatctcagcctatctctctggcaacatcaccttc
tacaccggggtttctaaggaggaattcaagaaggagacatttgatgtgacactggagcct
ttgtctatcaaggaagaggaagtgctggtgagagctggcgagtacatgggccagttactg
gaacaagcatctctgcaattcttcgtcacagctcgtgtcgataagacaggagatattctg
gccaagcagaagtccactgtgctgacaatccccaaggtcaacatcaaggtccgcggccca
aagatggttggttctgacatggttgtgacagttgagttcactaatcctttaaaagaaact
cttcaaaatgtttggatacatctggatggtcctggagtgataaaaccaaagagaaagctg
ttccgtgaaatccagcccaactccactgtgcagtgggaagaagtgtgtcggccttgggtc
tctggccatcggaagctgatagccagcatgaccagtgactccctgagacatgtgtatggc
gagctggatttgcagattcaaagacaaccttctatgtaa

DBGET integrated database retrieval system