KEGG   Pteropus alecto (black flying fox): 102882668Help
Entry
102882668         CDS       T02993                                 

Gene name
TGM5
Definition
transglutaminase 5
Orthology
K05622  
transglutaminase 5 [EC:2.3.2.13]
Organism
pale  Pteropus alecto (black flying fox)
Brite
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102882668 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 719 aa AA seqDB search
MAQGLELSVIDFRSSWNNMRHHTEEISSDRLLVRRGQAFNITLYFSNRGFQLGLDNIIFV
VETGPLPDLAKGTRAVFSLADHRGPSPWIASLETNRATSLEVSLYAPPTASMGRYLLKVH
IDSFQGSVTAYQLGEFILLFNPWCPEDTVYLDSEPQRQEYVMNDYGFVYQGNKNWIRPCP
WNYGQFEENIIDICLELLDKSLNFQSDPAMDCALRGSPVYISRVVCAMINSNDDNGVLNG
RWSENYSDGINPAEWTGSVAILRQWHATGCQPVRYGQCWVFAAIMCTVMRCLGIPTRVVT
NFDSGHDTDGNLIIDEYYDNTGRILKNKKKDTVWNFHVWNECWMARNDLLPGYGGWQVLD
ATPQETSNGFYCCGPASVRAIKEGEVDLNYDTAFVFSMVNADCVSWLVRGGKEQRLHRDT
NSVGNFISTKSIQSDERDDITEKYKYEEGSPQERKVFLKALQKLKIGSSQGPYGADLSPS
SPMHLSHYGPRSSDSPSLRPSDVIQVSLKLQLLDPPNMGQNIKFVLLALNMSPQFKDLKV
NLSAQSLMHDGSPLPPFWQDTAFITLSPEEAKTHPCQIPYSQYSQYLSTDKLIRISALGE
EKSYPKKILVDKIITLAYPAIMINVLGVAVVNQPLSVQVIFSNPLSEQVADCVLTVEGSG
LFKKQQKVIIGVLRPQHRASITLKTVPFKSGQRQIQANLRSNKFKDIKGYRNVYVDLRL
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagggctagagttgtccgtcatagacttccggagctcctggaacaacatgcgg
caccacacagaggaaataagctctgaccgcctccttgttcgccggggtcaggctttcaac
atcactctgtacttcagtaaccggggcttccagctgggcctggacaatatcatcttcgtg
gttgagactggaccactgccagacttggccaaggggactcgagctgtgttcagcctggca
gatcatcgtggtcccagtccttggatagcctcactggagaccaacagggccacctccctg
gaggtgagcctgtatgcccctcccacggcgtccatgggtcggtaccttttgaaagttcac
atcgactccttccaggggtctgtcacagcctatcagcttggagagttcattctgctcttc
aatccctggtgcccagaggacactgtctatttggacagtgagccccagaggcaggagtat
gtcatgaatgattacggcttcgtctaccaagggaacaagaactggatccgcccttgccct
tggaactacggacaatttgaagagaatatcatagacatctgcctggagttgctagacaag
agcctgaacttccagagtgacccagccatggactgcgccctgcggggaagccccgtctat
atcagcagagtggtgtgtgccatgatcaacagcaatgatgacaatggggtgctcaatgga
agatggagtgagaattactcagatggcatcaatcctgcagagtggaccggcagcgtggcc
atcctgagacaatggcatgccacaggctgccagccagtgcgctatgggcagtgctgggtc
tttgcagccatcatgtgcacagtgatgagatgcctggggatccccacccgagtggtcacc
aactttgactctggccacgacacagatggaaacctgatcatagatgagtattatgacaac
acaggcaggattttgaagaataagaagaaagacactgtctggaatttccacgtctggaat
gagtgctggatggcccgaaacgacctccttcctggatatggaggctggcaggtgctggat
gctacacctcaggagacaagcaacggcttttactgctgcggccctgcctctgtcagagcc
atcaaagagggagaggtggatctgaactacgacacggcctttgtcttttccatggtgaat
gctgactgtgtgtcctggcttgtccgtggaggaaaggagcagagacttcatcgagacaca
aattctgttggcaattttatcagcaccaagagcatccagagtgatgagcgggatgacatc
acggagaagtacaagtatgaagaaggttctcctcaggagaggaaagtgtttctgaaggct
cttcagaagctgaagattggaagctcccaaggcccctacggagcagacttgtcaccttcc
agtcccatgcatctgagccactatggtcctcgaagctcagattcaccttcccttcggccc
agtgatgttatccaggtttccctgaaacttcagctgctcgacccacccaacatgggccaa
aacataaagtttgtcctgctggccctcaacatgtcaccccagttcaaggacctcaaagtt
aacctgagcgcccagtctctgatgcatgatggaagccccctgcctccattctggcaggac
acagccttcatcacgctctctcctgaagaagcaaagactcatccctgccaaatcccctat
tcccaatacagccagtacttatcaacagacaagctgatccgcatcagtgccctcggagaa
gagaagagctatcccaagaagatcctagtggacaagatcatcaccttagcctatcccgcc
atcatgattaatgttctaggagtagccgttgtgaatcagccactctccgtacaggtgata
ttttcaaaccccctctcagagcaggtcgcagactgtgtgctgactgtggaaggaagtggt
ctcttcaagaagcagcagaaagttatcattggagtcctcagaccccaacacagggccagc
atcactctaaagactgtccccttcaagagtggccaaaggcagatccaagctaatctgagg
agcaacaagtttaaagacatcaagggttacaggaatgtctacgttgacttgaggttataa

DBGET integrated database retrieval system