KEGG   Pteropus alecto (black flying fox): 102882669Help
Entry
102882669         CDS       T02993                                 

Gene name
TGM7
Definition
transglutaminase 7
Orthology
K05623  
transglutaminase 7 [EC:2.3.2.13]
Organism
pale  Pteropus alecto (black flying fox)
Brite
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102882669 (TGM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 798 aa AA seqDB search
MMQQQDQVTSDQRGNVVEESEITSKSLGLKMRKWFANVRVSGRSEICRSGAWKIPDNIET
HCYHVTSVGRSAVRSHLVVAEIARVKSGPKRLVALELRSIDLQISRNNKEHHTKEMGLKR
LIVRRGQPFMLQLHFNRPLHSRTDHITFVAETGPAPMELLGTRATFPLTQARRGNVWSAS
DFTVDSNSLLVSLFTPADAVIGSYTLKIDISQRQDHIVTHPLGTFILLFNPWSAEDDVYL
PSETLLQEYVMLDYGFVYKGHERFITSSPWNYGQFEEDIIDICFEILNKSLYFLENPSKD
CSQRNDAVYVCRVVSAMINSNDDNGVLQGNWGEDYSLGVSPLEWNGSVAILRQWSAKGGQ
PVKYGQCWVFAAVMCTVMRCLGVPSRVVSNFRSAHSADGNLTIDTYYDQNAEVLSTWKQD
KIWNFHVWNECWMIRKDLPPGYNGWQVLDPTPQQTSSGLFCCGPASVKAIKEGEVHLAYD
TPFVYAEVNADEVIWLFRDGQAQEILAHNTSSIGKEISTKMVGSDQRQNITSFYKYSEGS
HEERSVFLKASRKMLGSRRTSSPFLDLLGSGGLGDQPAQLQLHLARTPEWGKDLLLKLHA
RRVPDRTHPQGPIRLEVRFCAQALLHKGGTREPLWRHIVHLNLDFGEEIQWPFLLPYNNY
RNKLTDEKLIRVSGIAKVEGTGKSILVLKDISLDPPHLSIELSERAEVGKALSIHITFTN
TQTVALSHCMMVLEGSGLIHGQISNDLGTLVAGHTIQIQLDLYPFKSGPHQLQVLISSNE
VKEIKGYKDIFVAAARAS
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcaacaggaccaggtgacttctgatcagagaggtaatgtggtggaagaatca
gaaatcacatcaaaatctctaggtttgaagatgagaaaatggtttgcaaatgtacgagtg
tccggcaggtcagagatatgccggagtggagcgtggaagattcctgataacattgagact
cactgctatcacgtgacatctgtgggaaggagtgctgtcaggtcacacctggttgttgca
gaaatagctagagttaaaagtgggccaaaaagattggtggccttggagctcaggtccatt
gacctgcagatctccaggaacaacaaggagcatcataccaaggagatgggcctgaagcgg
ctcatcgtgcgccgaggccagcctttcatgctccaactgcatttcaaccgacccctccac
tccaggacagaccacatcaccttcgtggctgagactggaccggcacccatggagctgctg
ggaacccgagctaccttcccactcacccaggcccgacgagggaatgtgtggagtgcctct
gatttcaccgttgactccaactcgctcctggtctcccttttcacaccagccgatgcagtc
atcggctcctacaccctgaagatagacatctctcagaggcaggatcacatcgtgactcac
cccctggggactttcatcctgctttttaacccttggagtgcagaggatgatgtctacctg
cccagtgaaacgctgctgcaggagtacgttatgttggactatggctttgtgtacaagggt
catgaaagattcatcacctcctcaccctggaactatgggcagtttgaagaggacatcata
gacatctgcttcgagatcctcaacaagagcctatacttcttggagaacccgtccaaagac
tgctcccagaggaatgatgcggtgtatgtctgcagggtggtgagtgccatgatcaacagc
aacgatgacaatggcgtgctgcaggggaactggggagaggactactccctgggggtcagc
ccactggagtggaatggcagcgtggccatcttgcggcagtggtcagccaagggcgggcag
cctgtgaagtatggacagtgctgggtcttcgcagctgttatgtgcaccgtaatgagatgc
ttaggtgttccaagccgtgttgtttccaatttccgttctgcacacagcgcagatgggaac
ttgaccatcgatacctactacgaccaaaatgcagaggttctgtcaacttggaaacaagat
aaaatatggaatttccatgtctggaatgagtgctggatgattcggaaagatctcccgcca
ggatacaatgggtggcaggttctggatcctactccccagcaaaccagcagcgggctgttc
tgctgtggccctgcctccgtgaaggccatcaaggaaggggaggtccacctggcctatgac
accccatttgtgtacgccgaggtgaacgccgacgaagtcatttggctcttcagggatggc
caagcccaagaaattctggcccataataccagttccatcgggaaggaaatcagcaccaag
atggtagggtcagatcagcgtcagaacatcaccagcttctacaagtattcagaaggatcc
catgaggagcggtctgtgttcttgaaggcttcccggaaaatgctgggctcaagaaggacc
tcctcacccttcctggatctgctggggtccggaggtttgggggatcagccagcgcagctg
cagctccacttggccagaacacctgagtggggcaaggacctgctgctgaagctgcatgcc
cggagggtgccagacagaactcacccccagggtcccatcagactggaggtccgcttctgc
gcacaggctctgctgcacaaaggtggcacccgggagcccctctggaggcatatagtgcac
ttgaacctggactttggggaggagatacagtggccgttcttgctaccttacaacaattac
agaaacaaactgacggatgaaaagctgatccgcgtgtctggcattgccaaagtggagggg
acagggaagtccatactggtcctcaaagatatatctctggatcctccccacttatctatt
gagctgtctgagagggctgaggtgggcaaagcactgagcatccacatcaccttcaccaac
actcaaacggtcgctctgagtcactgcatgatggtgctagagggaagtggcctcatccat
gggcagatatcaaatgaccttgggactctggtggcaggacacactatccaaattcaactg
gacctctaccccttcaaatctggacctcaccagctacaagtcctcatcagcagcaacgaa
gtcaaagagatcaagggctacaaggatatttttgtagctgcagccagggcttcttga

DBGET integrated database retrieval system