KEGG   Pteropus alecto (black flying fox): 102882740Help
Entry
102882740         CDS       T02993                                 

Gene name
DBH
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    102882740 (DBH)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     102882740 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 621 aa AA seqDB search
MQVPSPSAREAASMYGTAVAVFLVILVAALQGSAPPESPFPYRIPLDPEGTLELSWNVSY
TRELVHFQLLVRELKAGVLFGMSDRGQLEDADLAVLWTDGDKAYFGDAWSDQRGQLHLDP
QQDYQLLRAQRTPAGLSLLFKRPFSTCDPRDYLIEDGTVHLVYGILEQPFASLEAINTSA
LQTGLQRVQLLKPDISVPALPPDTRTMEVRAPDVLVPGQETTYWCYVTELPGGFSRHHIV
MYEPIVTEGNEALVHHMEVFQCAAELESVPQFSGPCDSKMKPARLNHCRHVLAAWALGAK
AFYYPEEAGLAFGGAGSSRFLRLEVHYHNPLRMQGRRDSSGIRLYYTATLRRFDAGIMEL
GLVYTPVMAIPPQEEAFVLTGYCTDKCTQLALPPSGIHIFASQLHTHLTGRKVITVLARG
GREREVVNRDDHYSPHFQEIRMLKKVVSVHPGDVLITSCTYNTGDRKLATVGGFGILEEM
CVNYVHYYPQTQLELCKSSVDPGFLQKYFHLVNRXWLGGGLLCSPSPSPSPAQRPPGPAR
HLGGRRDPDSGNRESTAGSHPWRPVSLXPVYLLAPSLQGEWDRQPLPEIVSKLEEPTPRC
PASQGQSPAGPTVVSIGGSKG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccccagccccagcgcccgtgaggccgcctccatgtacggcaccgcggtggcc
gtcttcctggtcatcctggtggccgccctgcagggctcggcgccccccgagagccccttc
ccctaccgcatccccctggaccccgagggcaccctggagctgtcctggaacgtcagctac
acgcgggagctggtccatttccagctgctggtgcgggagctcaaggccggcgtcctgttc
ggcatgtcggaccgcgggcagctggaggatgccgacctggccgtactctggactgacgga
gacaaggcctacttcggggacgcctggagtgaccagagggggcagctccacctggacccc
cagcaggattaccagctgctgcgggcgcagaggaccccggcaggcctgtccctgctcttc
aagaggcccttcagcacctgcgacccccgagattacctcatcgaggatggcaccgtccac
ctggtgtacggcatcctggagcagccgttcgcgtcgctggaggccatcaacacctcggcc
ctgcagacggggctgcagagggtgcagctgctgaagccggacatctccgtccccgccctg
cccccggacacgcgcacgatggaggtccgcgcccccgacgtcctcgtccccggccaggag
accacctactggtgctacgtcaccgagctcccgggcggcttctctcggcaccacatcgtc
atgtacgagcccatcgtcaccgagggcaacgaggcgctggtccaccacatggaggtgttc
cagtgcgccgccgagctcgagagcgtcccccagttcagcgggccctgtgactcgaagatg
aagcccgcccgcctcaaccactgccgccacgtgctggccgcctgggccctgggcgccaag
gccttctactacccggaggaagccggcctcgcgttcgggggcgcgggatcgtcacgcttc
ctccgcctagaggttcactaccacaacccgctgcggatgcaaggccggcgtgactcctcg
ggcatccgtctctactacacggccaccctgcgacgcttcgatgcgggcatcatggagctg
ggcctggtgtacacgcccgtgatggccatccccccgcaggaggaggcgttcgtcctcaca
ggctactgcacggacaagtgcacccagctggccctgcccccctcagggatccacatcttc
gcctcgcagctccacacgcacctgacggggaggaaggtgatcaccgtgctggccaggggc
ggccgagagagggaggtcgtgaacagggacgaccactacagccctcacttccaggagatc
cgcatgttaaagaaggtcgtgtccgtccacccgggggatgtgctcatcacttcctgcaca
tacaacacgggagacaggaagctggccaccgtgggtggcttcggcatcctggaggagatg
tgcgtcaactacgtgcactactacccccagacacagctggagctctgcaagagctccgtg
gaccccggcttcctgcagaagtatttccacctcgtgaacaggtgatggctcggggggggc
ctgctgtgctctccgtccccgtccccgtccccggcacagagacccccaggccctgcgagg
catctgggcggaaggagggatccagattccgggaacagggaaagcacggcgggcagccat
ccgtggcgccccgtttcgctctagcctgtttacctcctggctccgtccttgcagggtgaa
tgggaccgtcagcccctgccggagatcgtctccaagctggaagagcccaccccccggtgt
cccgccagccagggtcagagtcccgccggccccaccgtggtcagcatcggcgggagcaaa
ggttga

DBGET integrated database retrieval system