KEGG   Pteropus alecto (black flying fox): 102886354Help
Entry
102886354         CDS       T02993                                 

Gene name
TGM3
Definition
transglutaminase 3
Orthology
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
pale  Pteropus alecto (black flying fox)
Brite
Enzymes [BR:pale01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102886354 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 693 aa AA seqDB search
MKEEADLKLQNIDWQKTSNRQAHHTDKYYSQDLILRRGQSFKFLLTLNAPLRPGDNLGFI
VFTGPYPSESARTKAVFPLSNGTRGDSWSAQLVSQNNNTLTISIFSPANAPIGWYTLNIQ
INNYTLKLGMFILLFNPWLQADGVFMSNQAEREEYVQEDAGVIFVGSTDRISMVGWNFGQ
FEGDILNICLSILDNSLNFRRDPATDVARRSDPKYIGRVLSAMINSNDDNGVLAGNWSGS
YTGGRDPRNWNGSVEILKEWKSSGFRPVRYGQCWVFAGTLNTVLRSFGIPSRVITNFSSA
HDTDRNLSVDVYYDPMGNPLDKSSDSIWNFHVWNEAWFVRNDLGSSYNGWQVLDATPQER
SQGVFQCGPASVIAIREGDVNLDFDMPFIFAEVNADRITWIYDEKSNTQKQNSVATYGVG
KYISTKAVGSYSRIDVTEKYKYPEGSSQERKVFEKAKGKLKPNSSFSPTSGENIENEERE
PSISGKFKVIGTPTVGKEVNLALILKNLTSDMKTVTVNMTAWTIVYNGTLVQEVWKDSVT
ISLDPEEEINYPVKITYAQYEKYLKADNMIQTTAVCQASGEAEVVVERVVILDNPTLTLE
LLDQAQLRKPVNVQMLFSNPLDEPVKNCVLMVEGSGLLLGSLKIDVPTLRPKERSRVRFE
ILPTRSGTKQLVADFSCNKFPAIKAMLSVDVAE
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagaggcagatttaaaactccagaatattgactggcagaagacctccaaccgg
caggcgcatcacacagacaaatactacagccaggatctcatcttgcgaagaggtcaatcg
ttcaaatttttgttgaccttgaatgcacctctcagacctggagacaacctggggttcata
gtctttacagggccctatccctcagagtcagccagaacaaaggctgtgtttccactctct
aatgggacaagaggtgacagctggagtgcccagctcgtgtcccagaacaacaacactctg
accatctccatcttcagtcctgccaatgcacccataggatggtacacactgaacattcag
atcaacaattatactctgaaacttgggatgttcatactgctctttaacccctggttgcaa
gcggatggtgtctttatgagtaaccaggctgagagagaggagtacgttcaggaagatgcc
ggtgttatttttgtgggaagcacagatcgaattagtatggttggctggaacttcggacag
tttgaaggagacattctgaacatttgtctctcgatcctggataacagtctgaatttccgc
cgtgaccctgctactgatgtggcccgcagaagtgaccccaaatatattggccgggtgctt
agtgcaatgatcaatagcaatgatgataacggtgtgcttgctgggaattggagtggcagc
tacacaggtggccgggaccccaggaactggaacggcagtgtggagattctcaaggagtgg
aagtcatctggcttcaggccagtccgatatggccagtgctgggtctttgctgggacgctg
aatacagtgctgcggtcttttgggattccctcccgggtgatcaccaacttcagctcagct
catgacacagatcgaaacctcagtgtggatgtgtactacgaccctatgggaaatccactg
gacaaaagcagtgatagcatatggaatttccacgtctggaatgaagcctggtttgtgcgg
aatgacctgggctcttcgtacaatggatggcaggttctggatgccaccccccaggagagg
agccaaggggtgttccagtgcggccccgcttcggttatcgctatccgagaaggcgatgtg
aacctggacttcgacatgcccttcatctttgcggaggttaatgccgaccgcatcacctgg
atctacgatgagaaaagcaacacccagaagcagaattccgtagccacttacggtgttggc
aagtatatcagcaccaaggcggttggcagctactctcgcatagatgtcaccgagaagtat
aagtacccagaaggttccagccaggaaagaaaagtgtttgaaaaggcgaagggaaaactt
aaacccaacagctcattcagcccaacgtctggagaaaacatagaaaatgaggaacgggag
cccagcatctctgggaagtttaaggtcattggcacaccgacagtgggcaaagaagtcaac
ctggccctgatactcaaaaacctgacgagtgatatgaagacggtgacggtgaacatgaca
gcctggaccatcgtctacaatggcacgcttgtacaagaagtgtggaaagactctgtcaca
atatctctggaccctgaagaagaaataaattatcccgtgaagatcacgtatgctcagtat
gagaagtacctgaaggcagacaacatgatccagactacagctgtgtgccaggcctctggt
gaggccgaggtggtggtcgagagggtcgtcatcctggacaaccccaccctgaccctggag
ttgctggaccaagcccagttgcggaagcccgtgaatgtgcagatgctcttctccaatccg
ctggatgagccggtgaagaactgcgtgctgatggtggaggggagtggcctgctgctgggc
agcctcaagatcgatgtgccaaccctgcgccccaaggagcggtcccgggtgcgttttgag
atcctgcccacacggagtggcaccaagcagctggtcgctgacttctcctgcaacaaattc
cctgcaatcaaggctatgctgtctgtcgacgtggccgagtga

DBGET integrated database retrieval system