KEGG   Pteropus alecto (black flying fox): 102888547Help
Entry
102888547         CDS       T02993                                 

Definition
catechol O-methyltransferase-like
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102888547
  Amino acid metabolism
   00350 Tyrosine metabolism
    102888547
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    102888547
Enzymes [BR:pale01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102888547
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102888547
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 142 aa AA seqDB search
PPPPPTPGQIVDTVVQEQSPSILLELGAYCGYSAIRMARLMPPSARLLTIEINPAYAAIT
QQMVDFAGLQDKVTIVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEVSCT
AACLGWAGCCCRGCPVDGPQAL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
cctcctcctccacccaccccaggccagattgtggacacagtggtgcaggagcagagcccc
tccattctgctggagctgggggcctactgcggttactcggccatacggatggcccgcctg
atgccacccagtgctcgcctgctcaccatcgagatcaatcccgcctacgccgccatcact
cagcagatggtggacttcgcaggcctgcaggacaaggtaaccattgtcgtcggagcatcc
caggacatcatccctcagctgaaaaagaaatacgatgtggatacactagacatggtcttc
cttgaccactggaaggaccggtacctgccagacacactcctcctagaggtgagttgcaca
gctgcctgtctgggatgggctggctgctgctgccgtggctgccctgttgatgggcctcag
gctctctga

DBGET integrated database retrieval system