KEGG   Pteropus alecto (black flying fox): 102889003Help
Entry
102889003         CDS       T02993                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102889003 (PTGS1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    102889003 (PTGS1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102889003 (PTGS1)
  Nervous system
   04726 Serotonergic synapse
    102889003 (PTGS1)
Enzymes [BR:pale01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102889003 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 490 aa AA seqDB search
MLMRLVLTVRSNLIPSPPTYDSAHDYLSWESFSNMSYYTRILPSVPRDCPTPMGTKGKQQ
LPDAQLLSRRFLLRRVFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDL
GHIYGDNLERQHQLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGIPLQSQMAVGQE
VFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQ
QLSGYFLQLKFDPELLFSAQFQYRNRIAVEFNQLYRWHPLMPDTFKVGSQEYSYEQFLFN
TSMLVDYGVEALVDAFSRQSAGRIGGGRNIDHHVLHVAVEVIKESRELRLQPFNEYRKRF
GMKPYTSFQEFTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFS
LKGLLGNPICSPEYWKSSTFGGEIGFNIVKTATLKKLVCLNTKTCPYVAFRVPDPHQDGE
PAVERPSTEL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgcgcctggtcctcacagtgcgttccaaccttatccccagtcccccgacctac
gactcggcgcatgactacctcagctgggagtccttctccaatatgagctattacactcga
attctgccctctgtgccccgagactgccccacacccatggggaccaaagggaagcagcag
ctgccagatgcccagctcctgagccgtcgcttcctgctcaggagggtgttcatacccgac
ccccaaggcaccaatctcatgttcgccttctttgcgcaacacttcacccaccagttcttc
aaaacgtctggcaagatgggtcctggcttcaccaaggccttgggccacggggtagacctc
ggccacatttatggagacaatctggaacgccagcatcagctgcggctctttaaggatggg
aaactcaagtaccaggtgctggatggagaggtgtacccgccgtcggtggaagaggcaccc
gtgttgatgcactacccacggggcattccgctccagagccagatggcagtgggccaggag
gtgttcggcctgcttcctgggctcatgctctatgccacgctctggctgcgtgagcacaac
cgcgtgtgtgacctgctgaaggctgagcaccctacctggggcgacgagcagctcttccag
acgacccgcctcatccttatcggggagaccatcaagattgtgattgaggaatacgtgcag
cagttgagcggctacttcctgcaactcaagttcgacccggagctgctgttcagcgcccag
ttccagtatcgcaatcgtatcgccgtggagttcaaccagctctaccgctggcacccgctc
atgcctgacaccttcaaggtgggctcccaggagtacagctacgagcagttcctgttcaat
acctccatgctggtggactatggggtggaggccctggtggacgccttttctcgccagagc
gccggccggatcggtgggggtaggaacatagaccaccacgtcctgcacgtggcggtggaa
gtcatcaaggagtcccgagagctgcggctgcagcccttcaatgagtaccgcaagaggttc
ggcatgaagccctatacctccttccaggagttcacaggagaaaaggagatggcagctgag
ttggaggagttgtacggagacattgatgccttggagttctatccgggactgcttcttgag
aagtgccatccaaactccatctttggggaaagtatgatagaaattggggctcccttttcc
ctcaagggcctcttggggaatcccatctgttctccggagtactggaagtcaagcacattt
ggtggcgagataggcttcaacattgtcaaaacggccacactgaagaagctggtctgcctc
aacaccaagacttgtccctatgttgccttccgtgtgcccgacccccaccaggatggggag
cctgctgtggagcggccgtccacagaactctga

DBGET integrated database retrieval system