KEGG   Pteropus alecto (black flying fox): 102892638Help
Entry
102892638         CDS       T02993                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  
lipoprotein lipase [EC:3.1.1.34]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Glycerolipid metabolism
PPAR signaling pathway
Cholesterol metabolism
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102892638 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102892638 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102892638 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102892638 (LPL)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102892638 (LPL)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102892638 (LPL)
  Exosomal proteins of breast milk
   102892638 (LPL)
Glycosaminoglycan binding proteins [BR:pale00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102892638 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pale00537]
 Enzymes
  102892638 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 478 aa AA seqDB search
MESKGLLLVALGMWLQSLTASPGGVAAADKIIGGKDFLDIESKFSLRTPEDIAEDTCHLI
PGVTESVANCHFNHSSKTFVVIHGWTVTGMYESWVAKLVAALYKREPDSNVIVVDWLLRA
QHHYPVSAGYTKLVGKDVATFINWMEEEFNYPLDNIHLLGYSLGAHAAGIAGSLTNKKVN
RITGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGG
TFQPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAF
EKGLCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESDTQ
TNQAFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDVGELLMLKLKWQSNSYFSW
PSWWHSPGFDVEKIRVKAGETQKKVIFCSREKVSHLQKGKAAAVFVKCHDRSLNKKSG
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagggctgctcctggtggctctgggcatgtggctccagagtctgaccgcc
tcccccggaggggtggccgccgccgacaaaattataggaggaaaagattttctagacatc
gaaagtaaattttctctaaggacccctgaagacatagctgaagacacttgtcacctcatt
cctggagtgacagaatctgtggctaactgccacttcaaccacagcagcaaaaccttcgtg
gtgatccacggctggacggtgacaggaatgtatgagagctgggtggcaaagctcgtggct
gccctgtacaagcgggaaccggactccaacgtcatcgtggtggactggctgctgcgggcc
cagcaccactacccagtgtctgccgggtacaccaagctggtggggaaggatgtggccacg
tttatcaactggatggaggaggaatttaactatcctctggacaatatccatctcttggga
tacagcctcggagcccacgctgctggcattgcaggaagtctgacaaataagaaagtcaac
agaatcaccggcctagatccagccggacccaactttgagtacgcagaagctccaagtcgc
ctttctcccgatgatgcggactttgtagacgttttacacacattcaccagagggtcacct
ggccgaagtattggaatccagaaaccagtagggcatgttgacatttatcctaatggaggc
acttttcaaccaggatgtaacattggggaagctattcgtgtgatcgcagagagaggcctt
ggagatgtggaccagctcgtgaagtgctctcatgagcgctccattcatctcttcattgat
tctctgttgaatgaagaaaatcccagtaaagcctaccggtgcaattcaaaagaagccttt
gagaaagggctctgcctgagttgcagaaagaaccgttgcaacaacttgggctatgagatc
aataaagtcagagccaaaagaagcagcaaaatgtacctgaagacccgttctcagatgccc
tacaaagtcttccattaccaagtgaagatacatttttctgggactgagagtgatacacag
accaaccaggccttcgagatctctctgtacggcactgtggctgagagtgagaacattcct
ttcaccctgcctgaagtttccacaaataagacttattccttcctaatttacacggaagtg
gacgttggagaactactgatgttgaaactcaaatggcagagcaactcatacttcagctgg
cccagctggtggcacagccctggctttgatgtcgagaagatcagagtaaaagcaggagag
actcaaaagaaggtgatcttctgttccagggagaaggtgtctcatctgcagaaaggaaag
gcagctgcggtatttgtgaaatgccatgacagatctctgaataaaaagtctggctga

DBGET integrated database retrieval system