KEGG   Pteropus alecto (black flying fox): 102895201Help
Entry
102895201         CDS       T02993                                 

Gene name
JOSD2
Definition
Josephin domain containing 2
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
pale  Pteropus alecto (black flying fox)
Brite
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102895201 (JOSD2)
Peptidases [BR:pale01002]
 Cysteine Peptidases
  Family C86
   102895201 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 182 aa AA seqDB search
MSQGPPSVYHEQQRLELCAVHALNNVLQQRLFSQEAADEICKRLAPDSRLNPHRSLLGTG
NYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLPLRRRHW
VALRQVNGIYYNLDSKLRAPEVLGDEDGVRAFLAAALAQGLCEVLLVVTKEVEEKGCWLR
TD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagggtccgccctctgtgtaccacgagcagcagcgcctggagctgtgtgccgtc
cacgccctcaacaacgtcctccagcagcggctctttagccaagaggctgccgatgagatc
tgcaagaggctggccccagactcccgactgaaccctcatcgcagcctcctgggcaccggc
aactatgacgtcaacgtgattatggctgccctgcaggggctgggcctggccgccgtgtgg
tgggacaggaggaggcccctgtctcagctggccctgccgcaggtgctggggctgatcctg
aacctgccctcgcccgtgtcgctggggctgctgtcgctgccgctgcgccggcggcactgg
gtggccctgcgccaggtgaatggcatctactacaacctggactccaagctgcgggcgccc
gaggtcctgggggacgaggacggcgtcagggccttcctggcggccgcgctggctcaggga
ctgtgcgaggtgctgctcgtggtgaccaaggaggtggaggagaagggctgctggcttcgg
acggactga

DBGET integrated database retrieval system