KEGG   Pteropus alecto (black flying fox): 102896398Help
Entry
102896398         CDS       T02993                                 

Gene name
LYZL1
Definition
lysozyme-like 1
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pale  Pteropus alecto (black flying fox)
Brite
Enzymes [BR:pale01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     102896398 (LYZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MKAASILALIGCLATVTEPKVYTRCKLAKIFSRAGLDNYKGFSLGNWICMAYYESHYNTT
AETVLKDGSIDYGIFQINSYTWCRNAKLQEKNHCHVACSALLTDDLTDAIICAKKIVKET
EGMNYWQGWKKHCEGRDLSEWRKGCEVS
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgccagcatcttggccctgattggctgcctggccacagtcactgagcccaaa
gtctacactcgctgtaaactggcaaaaatattttcgagggctggcctggacaactacaag
ggcttcagccttggaaactggatctgcatggcgtactatgagagccattacaacaccaca
gctgagactgtcctgaaggatgggagcattgactacggcatttttcaaataaacagttat
acgtggtgcagaaatgcaaagctacaagagaagaaccactgtcatgttgcctgctcagcc
ttgctcactgacgacctcacagatgcaattatctgtgccaagaaaattgttaaagagaca
gaagggatgaactactggcaaggctggaagaaacactgcgaaggcagagacctgtctgag
tggagaaaaggatgtgaggtttcgtga

DBGET integrated database retrieval system