KEGG   Pteropus alecto (black flying fox): 102896433Help
Entry
102896433         CDS       T02993                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102896433 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102896433 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102896433 (MGLL)
  Environmental adaptation
   04714 Thermogenesis
    102896433 (MGLL)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102896433 (MGLL)
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S33
   102896433 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 303 aa AA seqDB search
MPEESSPKRTPQNIRYQDLPHLVNADGQYLFCKYWKPAGTPKALVFVSHGAGEHCGRYDE
LAQMLVGLELLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDFVQKDYPGVPVFLLG
HSMGGAIAILTAAERPGHFSGMVLISPLVLASPESATTFKVLAAKVLNLVLPNMSLGPID
ASVLSRNKTEVDLYNTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTAAVRTG
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggaaagttctcccaagcggacaccgcagaacattaggtaccaggacctccct
cacttggtcaatgccgatggacagtacctcttctgcaaatactggaaacccgcaggcact
cccaaggccctcgtctttgtgtcccatggagccggggagcactgcggccgctatgatgag
ctggctcagatgctggtggggctggagctgctggtatttgcccatgaccacgttggccat
ggacagagtgaaggggagaggatggtggtgtctgacttccacgttttcatcagggatgtg
ttacagcatgtagattttgtgcaaaaagactacccaggagttcctgtcttccttctgggc
cactccatgggaggtgccatcgccatcctcacagctgcagagaggccaggccacttctct
ggcatggttctcatttcacctttggttcttgccagtcctgagtctgcaacaactttcaag
gtccttgctgcaaaagttctcaaccttgtcctgccaaacatgtccctgggcccaatcgac
gccagtgtgctctctcggaataagacagaggttgacctttataacacggacccccttatt
tgtcgggctggactgaaagtgtgctttggaatccagctgctcaatgctgtctcgcgagtg
gaacgggcactccccaagctgactttgcccttcctgctgctccagggttctgctgaccgc
ctgtgcgacagcaaaggggcctacttacttatggagtctgccaagagccaggacaagaca
ctcaagatttacgaaggtgcctaccatgttctccacaaagagcttcctgaagtaaccaac
tctgtcttccatgaaataaacatgtgggtctctcaaaggacagcagcagtgagaacaggg
tctccaccctga

DBGET integrated database retrieval system