KEGG   Pteropus alecto (black flying fox): 102896433Help
Entry
102896433         CDS       T02993                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Glycerolipid metabolism
Metabolic pathways
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102896433 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    102896433 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    102896433 (MGLL)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102896433 (MGLL)
Peptidases [BR:pale01002]
 Serine Peptidases
  Family S33
   102896433 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 303 aa AA seqDB search
MPEESSPKRTPQNIRYQDLPHLVNADGQYLFCKYWKPAGTPKALVFVSHGAGEHCGRYDE
LAQMLVGLELLVFAHDHVGHGQSEGERMVVSDFHVFIRDVLQHVDFVQKDYPGVPVFLLG
HSMGGAIAILTAAERPGHFSGMVLISPLVLASPESATTFKVLAAKVLNLVLPNMSLGPID
ASVLSRNKTEVDLYNTDPLICRAGLKVCFGIQLLNAVSRVERALPKLTLPFLLLQGSADR
LCDSKGAYLLMESAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTAAVRTG
SPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggaaagttctcccaagcggacaccgcagaacattaggtaccaggacctccct
cacttggtcaatgccgatggacagtacctcttctgcaaatactggaaacccgcaggcact
cccaaggccctcgtctttgtgtcccatggagccggggagcactgcggccgctatgatgag
ctggctcagatgctggtggggctggagctgctggtatttgcccatgaccacgttggccat
ggacagagtgaaggggagaggatggtggtgtctgacttccacgttttcatcagggatgtg
ttacagcatgtagattttgtgcaaaaagactacccaggagttcctgtcttccttctgggc
cactccatgggaggtgccatcgccatcctcacagctgcagagaggccaggccacttctct
ggcatggttctcatttcacctttggttcttgccagtcctgagtctgcaacaactttcaag
gtccttgctgcaaaagttctcaaccttgtcctgccaaacatgtccctgggcccaatcgac
gccagtgtgctctctcggaataagacagaggttgacctttataacacggacccccttatt
tgtcgggctggactgaaagtgtgctttggaatccagctgctcaatgctgtctcgcgagtg
gaacgggcactccccaagctgactttgcccttcctgctgctccagggttctgctgaccgc
ctgtgcgacagcaaaggggcctacttacttatggagtctgccaagagccaggacaagaca
ctcaagatttacgaaggtgcctaccatgttctccacaaagagcttcctgaagtaaccaac
tctgtcttccatgaaataaacatgtgggtctctcaaaggacagcagcagtgagaacaggg
tctccaccctga

DBGET integrated database retrieval system