KEGG   Pseudoalteromonas aliena: B0W48_16835Help
Entry
B0W48_16835       CDS       T04815                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
paln  Pseudoalteromonas aliena
Pathway
paln00071  Fatty acid degradation
paln00072  Synthesis and degradation of ketone bodies
paln00280  Valine, leucine and isoleucine degradation
paln00310  Lysine degradation
paln00362  Benzoate degradation
paln00380  Tryptophan metabolism
paln00620  Pyruvate metabolism
paln00630  Glyoxylate and dicarboxylate metabolism
paln00640  Propanoate metabolism
paln00650  Butanoate metabolism
paln00900  Terpenoid backbone biosynthesis
paln01100  Metabolic pathways
paln01110  Biosynthesis of secondary metabolites
paln01120  Microbial metabolism in diverse environments
paln01130  Biosynthesis of antibiotics
paln01200  Carbon metabolism
paln01212  Fatty acid metabolism
paln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paln00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B0W48_16835
   00630 Glyoxylate and dicarboxylate metabolism
    B0W48_16835
   00640 Propanoate metabolism
    B0W48_16835
   00650 Butanoate metabolism
    B0W48_16835
  Lipid metabolism
   00071 Fatty acid degradation
    B0W48_16835
   00072 Synthesis and degradation of ketone bodies
    B0W48_16835
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B0W48_16835
   00310 Lysine degradation
    B0W48_16835
   00380 Tryptophan metabolism
    B0W48_16835
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B0W48_16835
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B0W48_16835
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B0W48_16835
Enzymes [BR:paln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B0W48_16835
Exosome [BR:paln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0W48_16835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQQ01288
UniProt: A0A1Q2H1N1
Position
complement(3771501..3772682)
Genome map
AA seq 393 aa AA seqDB search
MTLESVVIVAAKRTPMGGFMGALSDAQSTELGATAIASVLAQTGLANDAIDEVIMGCVLP
AGLGQAPARQAMLKAGLALSTGATTINKVCGSGLKAAMLANDLIKAGSIQSAIAGGMESM
TNAPYFIPKARGGMRMGHGEIKDHMMSDGLEDAYDNKAMGCFAQDTADEYGIGREQMDAF
ALGSLSKAKAAIQNGSFDNEVAPHTMQTRRGDVTVSIDEQPGNARPEKIPSLRAAFKKDG
TITAANSSSISDGGAALILMSESKAKEQGLTPLCKIVAHSTHSQKPSEFTVAPVGAMNSV
LEKAGWRAGDVDLWEINEAFAMVTMLAINELKLDASKVNVNGGACALGHPIGASGARILV
TLIHALKNRGLKKGIASLCIGGGEAVAMAVEAY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactttagaatcagtggtaattgtagcagcaaaacgcaccccaatgggtggatttatg
ggagcgttaagtgatgcgcagtctaccgagcttggcgctaccgccattgcaagtgtactc
gcacaaactggtttagctaatgatgcaatagacgaagttattatgggctgtgtattaccc
gcaggccttgggcaagcacccgcgcgtcaagcaatgttaaaagcagggcttgcacttagc
acaggtgctacaacaattaacaaggtatgtggctctggtttaaaagcggccatgcttgca
aacgatttaattaaagcgggctctatacaatcagctattgctggtggcatggaaagcatg
acaaacgcaccgtactttattccaaaagcgcgtggcggaatgcgcatgggtcacggtgaa
ataaaagatcacatgatgagcgatggccttgaagacgcctacgacaacaaagcaatgggt
tgttttgcacaagacaccgccgacgaatatggcattggtcgtgagcaaatggatgcattt
gcgttaggctcactaagtaaagcaaaagccgcaatacaaaacggcagttttgataacgaa
gttgccccgcatacgatgcaaacacgcagaggcgatgtaacagtatcgattgatgagcaa
ccaggtaatgcccgccctgaaaaaataccaagcctacgtgcagcgtttaaaaaagacggc
actattacagccgctaattcatcgtcaatttcagacggtggcgcagcgcttatattaatg
agcgaatcaaaagcaaaagagcagggcttaacaccgctttgtaaaattgtggcgcacagt
acgcattctcaaaaaccaagcgagtttaccgtagcgccagtaggggcaatgaatagcgtg
cttgaaaaagcaggttggagagccggcgatgttgacctttgggaaattaacgaagcattt
gccatggtaaccatgctagctattaacgagctaaaacttgatgcaagcaaagtaaacgtc
aatggcggcgcgtgtgcacttggtcacccaattggtgcaagcggcgcgcgtattttagta
acgcttattcacgcccttaaaaaccgaggccttaaaaaaggcattgcgtctttatgtatt
ggtggcggtgaagcagttgcaatggctgttgaggcatactaa

DBGET integrated database retrieval system