KEGG   Pantoea ananatis LMG 20103: PANA_0003Help
Entry
PANA_0003         CDS       T01195                                 

Gene name
rbsK
Definition
RbsK
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA_0003 (rbsK)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PANA_0003 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2596..3567)
Genome map
AA seq 323 aa AA seqDB search
MRHPSVAHLFRTPPMSKNAKLAVLGSINADHILNLAHFPRPGETVIGQKYQIAFGGKGAN
QAVAAGRAGANIAFIACVGADDIGERICQQLAQDNIDTHPVEAVEGESTGVAMIFVNGEG
ENNIGIYSGANAALTPQYVERHQQVIAQADALLMQLESPLDSVLAAATLARQHQTRVILN
PAPATKLSDDLLALIDIITPNETEAEILTGIAVNNDDDAARAAAALHEKGIATVLITLGR
RGVWLSENGKGQRIAGFEVNAVDTIAAGDTFNGAFITARLEGKAMHDAVRFAHAAAAIAV
TRSGAQPSVPWRAEIDDFLQQQG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccacccgtcggtggcgcacttatttcggactcctccaatgagcaaaaacgcaaaa
ctggccgttctcggtagcattaatgctgaccacatccttaatctggctcattttccccgc
cctggcgaaacggtgatcgggcagaaataccagattgcgtttggcggtaaaggcgcgaat
caggcggttgccgcgggtcgtgcgggtgcgaatatcgcttttatagcctgtgttggcgct
gatgacattggcgaacgtatttgccagcagctcgcgcaggacaatattgatacgcatcca
gtagaagccgtcgagggtgaatctacgggtgtggcgatgattttcgtgaatggcgaaggc
gaaaataacattggcatctattccggcgccaacgcggcattgacgccgcagtatgttgaa
cgtcaccagcaggtcattgcccaggcggatgccttactgatgcagttggaatcgcccctg
gacagcgttttggctgcggcgacgttggccagacagcatcagacccgcgtgattttaaat
cctgctccggcaacgaaactgtctgatgatttgttagcgcttatcgacatcattacgccg
aatgaaactgaagctgaaattctgaccggtattgcggtaaataatgatgatgatgcagca
cgtgccgccgccgcattgcatgaaaaaggtattgctaccgttttgattaccctgggacgc
cgtggcgtctggctcagtgaaaatgggaagggacaacgtattgccggctttgaggtcaac
gcggtcgacaccattgctgctggcgatacctttaacggtgcgtttatcactgcgcgactt
gaaggtaaggccatgcatgatgccgttcgttttgcccatgccgccgcggcaattgcggta
acccgttcaggtgcgcagccttctgtaccgtggcgtgcggaaatcgacgactttttacag
cagcagggttaa

DBGET integrated database retrieval system