KEGG   Pantoea ananatis LMG 20103: PANA_0062Help
Entry
PANA_0062         CDS       T01195                                 

Gene name
bglA
Definition
BglA
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0062 (bglA)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     PANA_0062 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(67217..68599)
Genome map
AA seq 460 aa AA seqDB search
MNYRFPENFWWGSASSALQAEGDSLNGGKSPTTWDRWFAQQPHRFHQGIGPQDTSGFYQH
WQHDIALLKQLGHNSFRTSLSWARLMPDGTDAVNPDAVAFYNKVIDALLAQGITPFITLF
HFDMPLAMQDKGGWENREVVEAFGRYAQRCFALFGHKVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFRRAANVALHTVLAHALAVRAWRNGGYDGDIGVVLNLTPSYSRSANPADVQAAH
HADLLFNRSFLDPVLKGEYPVDLLSLLSQYHQLPRCQPGDAALIADGIIDLLGVNYYQPR
RVKCRDSAVNAEAPFMPEWLFDHYEMPGRQMNPYRGWEIYAPGIYDILTNLRVNYGNPRC
FISENGMGVENEQRFIQNGEILDDYRIEFVSEHLKWLHKGIREGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQKRTIKKSGKWFAEVAENNGFN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccgttttcctgaaaatttctggtggggcagcgccagctcggcgttacaagcc
gaaggggacagcctgaatggcggtaaaagccctaccacctgggatcgctggtttgcacaa
cagcctcaccgtttccatcaaggcattggcccacaagacacctcgggcttttatcagcac
tggcagcacgatatcgcattactaaagcagttagggcacaacagctttcgcacgtcgctg
agctgggcgcgcctgatgccagacggcactgacgccgtgaatcctgacgccgtggctttt
tataacaaggtcatcgatgcattactggcgcagggcattacaccgtttatcaccctgttt
catttcgatatgcctctggctatgcaggacaaaggcggctgggagaaccgtgaggttgtg
gaggcatttggccgctatgcccagcgctgtttcgcgctgttcggccataaggtgaaacac
tggtttaccttcaatgaaccgattgtgccggtcgaaggtggctatctgtacgattttcat
tatcccaacgttgtggacttcagacgagcggctaacgtggccttgcacacagtcctggca
cacgcgctggcagtacgcgcctggcgtaacggcggctacgacggtgacattggtgtggtg
ctgaacctcacgccgtcctattcacgatcggcgaatccggccgatgtgcaagccgcacat
catgctgacctgttgtttaaccgtagctttctggatccggttctgaagggagaatatccc
gtggatctgctgagcttactgagtcagtaccaccagcttccgcgctgccagcctggcgac
gctgcgttgattgccgacggcattatcgaccttctgggcgtgaactattatcagccgcgc
cgggtaaagtgtcgggacagcgccgtcaatgctgaagcgccctttatgccggagtggtta
ttcgaccactatgaaatgccaggccgtcagatgaacccgtatcgtggatgggaaatttac
gcgcccggtatttacgatattctgactaacctgcgggttaattatggaaacccgcgctgt
tttatttctgaaaatggtatgggcgttgagaatgaacagcgatttattcagaacggtgaa
attctggatgattatcgtatcgaatttgtttccgaacatcttaaatggctgcataaaggg
attcgcgaaggctgtcattgcctgggttatcatatgtggacatttattgataactggtca
tggctaaacggttataaaaatcgttacggttttgtgcagttagatttagccacgcaaaaa
cgtacgattaaaaagagtggcaaatggtttgctgaggttgccgaaaataacggttttaat
tga

DBGET integrated database retrieval system