KEGG   Pantoea ananatis LMG 20103: PANA_0132Help
Entry
PANA_0132         CDS       T01195                                 

Gene name
celY
Definition
CelY
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pam00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
149823..150827
Genome map
AA seq 334 aa AA seqDB search
MRVKPVWSGILVLFMMFFSTQAMASGWDTYKSRFLQSDGRIIDTANNNVSHTEGQGYGML
LAVAYNDRASFDKLWKWTRTNLRNPQNDLFYWRYIPDAQDPVADKNNASDGDVLIAWALQ
RAAQKWNASDYQQESDRIQRAIVKLDVTNFGGYTVMMPGAQGFNKNSYVVLNPSYFLFVA
WQEFGQRSHLQVWNKLIDGGMALLGKMHFGNSDLPLDWVALNADGSVAPAVGYSNRFSYD
AIRVPLNIWWYDPQSLALGPFQRLWQGYGRMNTPAWFDVLANTAAPYHLEGGLLAVRDLV
LNETGYLSDKLSPEQNYFSASLQLLTWMAYQEKR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaagccagtgtggtccggtattctggtcttgtttatgatgtttttcagcacc
caggcgatggcaagtggttgggatacctataaaagccgctttcttcagtcagacggacgc
attattgatacggcaaataataatgtcagtcacacggaaggccagggttacggcatgttg
ctggcggtcgcttataacgatcgcgcgtcgttcgataaactctggaagtggacgcgcacg
aacctgcgcaatccgcaaaacgatctgttctactggcgctacattcctgatgcacaggat
cctgtcgcggataaaaataacgcgtccgatggcgatgtgctgattgcatgggcgttgcaa
cgggcagcgcaaaaatggaatgcaagcgattatcagcaggaatcggaccgcattcagcgt
gcgatagtcaaactcgatgtgacgaacttcggtggctacaccgtaatgatgccgggcgcg
cagggattcaataagaacagctatgtggttttgaatccctcttatttcctgtttgtcgcc
tggcaggagttcggccagcgcagccatttgcaggtctggaacaagctgattgacggcggg
atggcgctgctgggcaagatgcattttggcaacagcgatctgccgcttgactgggtcgcg
ctgaacgccgatggctccgtcgcgcccgcggtgggttattcaaatcgctttagttacgat
gccatccgcgtgccgctgaatatctggtggtacgatccgcaaagcctggcgctggggcct
ttccagcgactctggcagggctatggtcgtatgaatacgccggcctggtttgatgtgctg
gccaatacggcggcgccttaccatctggaaggcggcttgctggcggtacgtgatttggtg
ctcaacgaaacaggctacctgagtgacaaactgtctcctgagcagaactacttttctgcc
agcctgcagttactgacctggatggcttatcaggaaaagcgttga

DBGET integrated database retrieval system