KEGG   Pantoea ananatis LMG 20103: PANA_0176Help
Entry
PANA_0176         CDS       T01195                                 

Gene name
pldA
Definition
(GenBank) PldA
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00564  Glycerophospholipid metabolism
pam00565  Ether lipid metabolism
pam00590  Arachidonic acid metabolism
pam00592  alpha-Linolenic acid metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PANA_0176 (pldA)
   00565 Ether lipid metabolism
    PANA_0176 (pldA)
   00590 Arachidonic acid metabolism
    PANA_0176 (pldA)
   00591 Linoleic acid metabolism
    PANA_0176 (pldA)
   00592 alpha-Linolenic acid metabolism
    PANA_0176 (pldA)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     PANA_0176 (pldA)
    3.1.1.32  phospholipase A1
     PANA_0176 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ADD75343
UniProt: D4GGP2
Position
201903..202850
Genome map
AA seq 315 aa AA seqDB search
MCRMSCFLQHPFAFMNTQFPLENPMRKHRALLAAMLLPALAQADEATIKHVHDAPQVRGS
IIANLLEQHDNPFVLYPYENNYLLYTYTSDINKEAISSYNWAQNARKDEVKFQLSLAFPL
WRGILGDNSVLAASYTQRSWWQLSNKKESSPFRETNYEPQIFLGWATDYSFAGWTLRDVE
VGVNHQSNGRSDPTSRSWNRVYTRLMAQNGNFLAEIKPWFRISESASTDDNPDITKYMGY
YRAKVGYAMGDSIFSVEGNYNWNSGYGGATLGWSYPITQHVRFYTQLFSGYGESLIDYNH
RQTRLGVGVTLNDLF
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtagaatgtcctgctttttacaacacccattcgcttttatgaatacgcagtttcca
ctggagaatcctatgcgtaagcatcgcgccttgctggcggcaatgttacttcctgctttg
gcgcaggcggacgaagccacgatcaaacacgttcacgatgcaccccaggttcgtggcagc
attattgccaacctgctggagcagcatgacaacccgtttgtgctttatccttacgaaaat
aactatctgctttacacgtacactagcgacattaataaagaggcgatttcctcttataac
tgggcgcagaatgcccgtaaggacgaagtgaaattccagcttagtctggcatttccactg
tggcgcggcatcctgggtgacaactccgtgttagccgcgtcctatactcagcgctcatgg
tggcagctatccaataaaaaagagtcgtcgcccttccgcgagacaaactatgagccgcag
attttcctgggctgggcgaccgattattcgtttgccggctggacgctacgtgatgttgaa
gtgggcgtgaatcatcagtccaatggccgtagcgatcccacgtcacgcagctggaaccgt
gtttatacccgcctgatggcgcaaaacggtaatttcctcgcagagatcaaaccctggttc
cgtatttctgagagcgccagcacggacgataacccggatattacaaaatacatgggctac
tatcgggcgaaagtgggctatgcgatgggtgacagcattttcagcgtggaaggcaactat
aactggaatagcggttacggcggcgctacgctgggctggagttatcccatcacccagcac
gtgcgtttttacacccagctgtttagcggctatggtgaatctctcattgactataaccac
cgtcagactcgtttaggcgtaggtgtgacccttaacgatttgttctaa

DBGET integrated database retrieval system