KEGG   Pantoea ananatis LMG 20103: PANA_0180Help
Entry
PANA_0180         CDS       T01195                                 

Gene name
pldB
Definition
PldB
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PANA_0180 (pldB)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PANA_0180 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206040..207143
Genome map
AA seq 367 aa AA seqDB search
MYSLSRLKCDTIRQNAAQGYGHHAAVQTLFFRQSGGRMKQHRASWLQREKAFAAFATGPL
LDFWHSREECEFTGVENLTLRYVRFISPQHKRVIVIVPGRIESYVKYPELAYDLFQCGFD
VIVLDHRGQGRSDRLLDDSHLGHVVEFSHYVDDLETLYLKEIVSRHYQQRYALAHSMGGA
ILALFLARQPGAFHAAALVAPMFGIALPLPSFLAHKILDWAEKRPAVRDGYALGTGRWRA
HPFGINRLTHSHERYRRSLRFYADDPAIRVGGPTYHWVREGIHAGRNIFSQVDKITTPLL
LLQASEDSVVDNRSQDLFCAAMAAAGHPCEGDKPQVIKGARHEILFEKDSMRAEALNGIV
DFFLSHH
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttgtactccctgtcacgtctgaagtgtgacacaatacgccagaatgctgcgcagggctat
ggacatcatgcggccgttcagactctttttttccggcaatcaggagggcggatgaagcaa
cacagagcaagctggctgcaacgcgaaaaggccttcgctgccttcgcgaccggcccactg
cttgatttctggcacagccgtgaagagtgtgaatttaccggtgttgaaaatctgacctta
cgttacgttcggttcatttcaccgcaacacaagcgcgtgattgtaatcgttcccgggcgc
attgagagctacgttaaatatcccgagctggcctacgatctgtttcaatgtgggttcgat
gtgatcgtgctcgatcaccgtggtcaggggcgatccgatcggctgctggatgattcgcat
cttggacatgtggtggagttttcccactatgtcgatgaccttgaaacgctctatctgaaa
gagattgtgagccgtcattatcaacaacgttatgcgttggcgcattcaatggggggcgca
attctggccctgttcctggcgcgtcagcctggcgcgtttcacgctgcggctctggttgcg
ccgatgtttggcatcgcgctgccgttaccctcttttctggcgcataagatcctcgactgg
gcagagaaacgacctgccgttcgcgatggctatgcattaggcacggggcgctggcgggct
catccctttggcattaaccgtctgacgcacagtcatgaacgttatcgtcgcagcctgcgt
ttttatgcggacgacccggcgattcgtgttggcggtcccacctatcactgggtacgggaa
ggcattcatgccggacgcaacatattcagtcaggttgataagataacgacgccgctattg
ctgcttcaggcaagcgaagacagcgtggtggataaccgctcacaagatctgttttgcgcc
gccatggcggcagccggtcatccctgtgagggcgataagccccaggttattaaaggtgca
cgccacgagattctgtttgaaaaagacagcatgcgcgccgaagcattgaatgggatcgtc
gatttctttttatcgcatcactag

DBGET integrated database retrieval system