KEGG   Pantoea ananatis LMG 20103: PANA_0201Help
Entry
PANA_0201         CDS       T01195                                 

Gene name
fadB
Definition
(GenBank) FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00071  Fatty acid degradation
pam00280  Valine, leucine and isoleucine degradation
pam00281  Geraniol degradation
pam00310  Lysine degradation
pam00362  Benzoate degradation
pam00380  Tryptophan metabolism
pam00410  beta-Alanine metabolism
pam00640  Propanoate metabolism
pam00650  Butanoate metabolism
pam00903  Limonene and pinene degradation
pam00930  Caprolactam degradation
pam01040  Biosynthesis of unsaturated fatty acids
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01212  Fatty acid metabolism
Module
pam_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PANA_0201 (fadB)
   00650 Butanoate metabolism
    PANA_0201 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PANA_0201 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PANA_0201 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PANA_0201 (fadB)
   00310 Lysine degradation
    PANA_0201 (fadB)
   00380 Tryptophan metabolism
    PANA_0201 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PANA_0201 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PANA_0201 (fadB)
   00281 Geraniol degradation
    PANA_0201 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PANA_0201 (fadB)
   00930 Caprolactam degradation
    PANA_0201 (fadB)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PANA_0201 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PANA_0201 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PANA_0201 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PANA_0201 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADD75368
UniProt: D4GGR7
Position
complement(228231..230414)
Genome map
AA seq 727 aa AA seqDB search
MLYQGANLTLNQLDDGIVELVFDAPGSVNKLDTQTVASLGEAIAVLEQHADLRGVLLSSA
KPAFIVGADITEFLALFDAPTEKLSQWLTFANSIFNRLEDLPVPTIAAIDGYALGGGCEC
VLATDLRVATPTARLGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDIDGMAALR
LGLVDAVVSPDKLRDAALTMLKAAASDGSWRARRAPKLAPLKLSPVEAAMSFTIAKGMVM
QTAGKHYPAPLTAVKTIEAAAALGRDDALKLETAAFVPLAQSDVARALVGIFLNDQYIKG
LAKKRSSENGAPKQAAVLGAGIMGGGISYQSAWKGVPVKMKDIHPQALTLGMNEASKLLN
KQLERGKIDGNKLAAVIATIQPTLDYAGFNQADVVVEAVVENPQIKASVLAETEKHMRSD
AILASNTSTIPISQLAQALQRPENFCGMHFFNPVPRMPLVEVVRGEKTSEATLGKVVAWA
SKMGKTPVVVNDCPGFFVNRVLFPYFAAFGMLLRDGADFRQIDKVMEKQFGWPMGPSWLL
DVVGIDTAHHAQSVMADGFPQRMKKDYRDAIDILFEAKRFGQKNGKGFWRWEEDKKGKPK
KVSDPEVDALLEPACQPKRIFSDEEILNRMMLPMLNEVVRCLEEKIIASPAEADMALVYG
LGFPPFRGGAFRYLDTLGNSNVVDQAKRYTALGGLYELPALLSEKARQHESWYPAVKPID
EAAFRSA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgctaacctcactcttaatcagttggacgacggcattgtcgagctg
gtgtttgatgcccccggctcggttaataagctggatacacaaaccgttgccagcctcggc
gaagcgattgctgtgctggagcaacacgccgatctgcgcggcgtgcttctgagctcagct
aaacccgcctttatcgttggggctgacatcaccgaattccttgcgctttttgacgcgcca
acggaaaagctgagccagtggctgacgttcgcaaacagcatttttaatcgtctggaagat
ttacccgttcccaccatcgccgcgatcgatggctacgcgctgggtggtggctgtgaatgt
gttctggcgacggacttacgggttgccacgccgaccgcccgcctgggcttacctgaaacc
aagctgggcatcatgccgggttttggcggcagcgttcgcctgcctcgcctgttgggtgct
gacagcgcgctggaaatcattgcggcaggtaaagatattgatggtatggctgcgctcagg
ctgggtctggtcgatgcagttgtcagccctgataaactgcgcgatgcagcgctgacaatg
cttaaagcggcagccagtgatggcagttggcgggcacgtcgcgcccctaaattagcgccg
ttaaaactcagccctgttgaagccgcaatgagttttacgatcgctaaaggcatggtcatg
caaacggccggaaaacattatcctgcgccgctcaccgccgtgaagacgatcgaggccgca
gccgcattaggacgtgacgatgcgttaaaactggaaacggcggcgtttgttccgttggcg
caatcggatgtggcccgcgcgctcgtcggaattttcctcaacgatcagtacattaaaggg
ctggcaaaaaaacgcagcagcgaaaatggtgcgccgaagcaggctgccgtgctgggcgcc
gggattatgggtggcggcatcagctatcagtcggcgtggaaaggtgtgccggtcaagatg
aaggatattcatccgcaggcgctgaccctgggcatgaacgaagccagtaagcttctgaac
aagcagctggagcgaggtaagatagacgggaataagctggctgccgtcattgccaccatt
caacctacgctggattatgccggatttaatcaggccgatgtcgtggtcgaagccgtggtg
gaaaacccgcagatcaaagccagtgtgctggctgaaacagaaaagcatatgcgcagtgat
gccatcctggcctcgaatacctctacgatccccatcagccagctggcgcaggcactgcag
cgtcccgaaaacttttgcggtatgcacttctttaatccggttccccgtatgccgctggta
gaagtggttcgcggagagaaaaccagtgaagcgacgttgggtaaagtcgtggcatgggcc
agcaagatgggcaaaacccctgtcgtggtgaatgactgtcctggcttcttcgtaaaccgt
gttctgttcccttactttgccgcgttcggcatgttgttgcgtgatggtgcggatttccgc
caaatcgataaagtgatggaaaaacagtttggctggccgatgggcccttcctggctgctg
gatgtcgtggggattgataccgcacatcatgcgcaaagcgtgatggcggatggtttccca
cagcgtatgaaaaaagactatcgcgatgctatcgatattctgtttgaagcaaaacgcttt
ggtcagaaaaacggtaaaggcttctggcgttgggaagaagacaaaaaagggaaacctaaa
aaagtctctgatcccgaggtcgatgcgctgcttgaacctgcctgccagcctaagcggatc
ttcagtgatgaagaaatcctgaaccgcatgatgttgccaatgctgaatgaagttgtccgc
tgtctggaagagaagattattgcttcacctgccgaggcagacatggcgctggtgtacggc
ctgggattcccgccattccgtggcggggctttccgttatctcgacacgctggggaacagt
aatgtcgtggatcaggcgaaacgctatacggcactgggcggcctgtatgagctgcctgcc
ctgctgtcagaaaaagcgcgccaacatgaaagctggtatcccgccgtcaaaccgattgat
gaagccgcgttcagaagcgcctga

DBGET integrated database retrieval system