KEGG   Pantoea ananatis LMG 20103: PANA_0233Help
Entry
PANA_0233         CDS       T01195                                 

Gene name
aceB
Definition
(RefSeq) AceB
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA_0233 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PANA_0233 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    PANA_0233 (aceB)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PANA_0233 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
282081..283679
Genome map
AA seq 532 aa AA seqDB search
MTDSVINSELLFSKPFNDAEKQLLTPDAIAFLQELVTRFAPQRERLLAARQVRQKEYDSG
GLPDFDMETVSIRERAWTIRGIPADLQDRRVEITGPPDRKMVINALNANVKVFMADFEDS
LAPCWEKLIDGQQTLREAVAGTLRYTSENGKIYQLRADPAVLMCRVRGLHLSEKHVSWQG
NAIPGGLFDFALYFFHNAEALLAKGSGPYFYLPKTESWQEVAWWRDIFSFAEDRFDLARG
TIKATVLIETLPAVFQMNEILWNLRDHIVGLNCGRWDYIFSYIKTLREHADRILPDRQSV
TMAQPFLDAYSRLLIQTCHRRGAFAMGGMSALIPSKDSARNEWVLQRVTEDKQREANNGH
DGTWIAHPGLADTAMSVFNQVLGERPNQLNILRQDDSPITAEQLLAPCEGDRTEAGMRAN
IRVALQYLEAWISGNGCVPIDGLMEDAATAEIARTSIWQWIRHQKSLLDGQPVTAALFQQ
LLNDELQTLQMHLGDKTFSSGRYEEAARLMAQITTQDELVSFLTLPGYRLLP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacagactcggttatcaacagtgaattacttttcagtaaaccctttaacgatgcggaa
aagcagttgcttactcctgacgccatcgcttttctgcaggaactggtgacgcgttttgca
ccccagcgtgagagattgttagccgcacgtcaggtccggcaaaaagagtacgattccggc
gggttacctgactttgatatggaaacggtttccataagagagcgagcgtggacgatccgt
ggtattccggccgatttacaggatcgtcgcgttgagatcaccggtccgcccgatcgcaaa
atggtgattaacgccttgaatgctaacgtaaaggtgtttatggccgactttgaggactcg
ctggcaccttgctgggaaaaactcattgacggacagcaaaccttacgggaagccgtggcg
ggaacgctgcgctataccagcgagaacggaaaaatctatcagctacgggccgatcctgcg
gtattgatgtgccgggtacgtggactgcatctgtctgaaaaacatgttagctggcagggc
aatgcgattcccggtggtctgtttgattttgctctctacttttttcataacgcggaagcc
ttactggcaaaaggcagtggcccctatttttatctgcctaaaactgagagctggcaggaa
gttgcgtggtggcgggatatctttagctttgccgaggatcgttttgatctggctcgcggc
accataaaagccaccgtattgatcgaaacgctaccggcggtattccagatgaacgagatc
ctgtggaatctgcgggatcatatcgtggggctgaactgcggccgctgggattatattttc
agctatatcaaaacgctgcgcgaacatgccgatcggattctgcccgaccggcagtctgta
accatggctcagccctttctggatgcttactcacgactgctgatccaaacctgccatcgc
cgcggtgcttttgccatgggcggcatgtcagcactgatacccagcaaggacagcgcgcgc
aatgaatgggtgctgcagcgcgtcactgaagataaacagcgtgaagccaacaacggacat
gacggtacctggatcgcgcatcccggcctggcagacactgcgatgtcagtcttcaaccag
gtactgggtgaacgccccaatcagctcaacattctgcggcaggatgacagcccgataacg
gcagagcagcttctggcaccctgcgaaggcgatcgaacggaagcgggcatgcgcgccaat
attcgggtggcgttgcagtatctggaagcctggattagcggcaatggctgtgtccccatc
gatggcctgatggaagatgccgcaactgcagaaattgcccggacttcaatctggcaatgg
atccgccatcagaaatctctgctcgatggacagccggtcacggccgcgctcttccagcag
ctgctgaacgatgagctgcaaacgctacagatgcatctgggcgataagacattcagttca
ggtcgttatgaggaagcggcgcgcctgatggcgcagatcacaactcaggacgaactggtt
tcctttctgactctgccaggctaccgcctgcttccctga

DBGET integrated database retrieval system