KEGG   Pantoea ananatis LMG 20103: PANA_0234Help
Entry
PANA_0234         CDS       T01195                                 

Gene name
aceA
Definition
(RefSeq) AceA
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA_0234 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PANA_0234 (aceA)
Enzymes [BR:pam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PANA_0234 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
283697..284998
Genome map
AA seq 433 aa AA seqDB search
MTRTQHIQQLEKQWQDARWQGITRPYSAEEVINLRGSVVPACTLAERGRLKLWSLLNGDA
KKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANVAGQMYPDQSLYPVNSVPEVV
TRINQTFQRADQIQWANGTEPGDSRYIDYFLPIVADAEAGFGGVLNAFELMKSLISAGAA
AVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTILLARTDADAADLI
TSDCDEYDRPFIRGDRTAEGFFRTNAGIEQAISRGLAYAPYADVLWCETSTPDLAMAQRF
ADAIHARYPGKLLAYNCSPSFNWKKNLDDKTIAAFQQALSDMGYRFQFITLAGIHSMWFN
MFDLAHAYAQGEGMRHYVEKVQQPEFAARERGYSFSSHQQEVGTGYFDQVTNTIQGGKSS
VTALTGSTEEHQF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtactcaacatattcagcaacttgaaaaacagtggcaggacgcgcgctggcag
ggcattacccgcccgtacagcgcagaggaagtgattaacctgcggggctctgttgtgccg
gcctgtactctggcagagcgggggcggttgaagctctggtcgctgctcaatggcgacgcc
aaaaaaggctatatcaacagtctgggagcattaacgggcggtcaggctctgcaacaggca
aaggccggtatagaagcgatctacctgtctggctggcaggtcgctgccgatgccaacgta
gcagggcaaatgtatccggatcagtcgctttatccggtcaactccgtgcctgaggtggtc
acccgtattaatcagacattccagcgcgccgatcagattcagtgggctaacggcacagaa
cctggggacagccgctatatcgactattttctgcctatagtcgccgatgcagaagcgggc
tttggtggcgtgctgaatgcgtttgaactgatgaagtcattgatcagcgcaggcgcggcg
gccgtgcactttgaagatcaactggcggcggtgaagaaatgcggtcatatgggcggtaag
gtgctggtgccaacccaggaggcgatacagaagctggtggcggcgcgtctggctgccgat
gtcatgggcgtacccacgatcctgctggcgcggaccgatgcggatgccgcagacctgatc
acgtctgactgtgacgaatacgaccgcccatttatacgcggcgaccgcacggcggaaggt
tttttccgcaccaacgccggcattgagcaggcaatcagccgtggactggcttacgcccct
tacgccgatgtcctttggtgtgaaacctccaccccggatttggccatggcccagcgtttt
gccgatgcgattcacgcccgctacccaggcaagctgctggcttacaactgttcgccttcg
tttaactggaaaaagaatctggatgacaaaaccattgcggccttccagcaggcgctcagt
gacatgggctatcgctttcagttcattacgctggcgggcatccacagcatgtggttcaac
atgttcgatcttgcgcacgcttacgctcagggcgaaggcatgcgccactatgtggaaaaa
gttcagcagccggagtttgctgcgcgcgaacggggttacagcttttcatcgcatcagcag
gaggtcggaacaggctatttcgatcaggtgaccaacacgattcagggcggcaagtcatcg
gtgacggccctgacagggtccaccgaggagcatcagttttga

DBGET integrated database retrieval system