KEGG   Pantoea ananatis LMG 20103: PANA_0376Help
Entry
PANA_0376         CDS       T01195                                 

Gene name
cex
Definition
Cex
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
pam  Pantoea ananatis LMG 20103
Brite
Enzymes [BR:pam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     PANA_0376 (cex)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448347..449582
Genome map
AA seq 411 aa AA seqDB search
MQRIAADGEVVWRYKKAGAGPTWPEYCPLESGGIVALRLTDTVFTSTSPCRRRFLKSSAA
LMLAGALPLPVLASIPPFPALKTVAAQSHRLFGFAVRPDSLQSDAHYRQFVASQASIIVP
ENALKWMAVHPARDRYDFAGPDAIAAFAREQGIRLRGHTFCWHRALPDWVQAIADEAELE
KVLRQHIATVAGRYRGQIHSWDVANEIINLADGQPGGWRNSFWYQRLGTRYMDIACEALH
QADPHAVICYNDYGLESDDVSGQRKRAAVLAMLRDLQSRHIPIGALGIQSHLKAGPHPAF
GPGLAAFIHDVKSLGLKVYITELDVDDSSVPMESRPMAVAALYKRYLSLVLEAGVAAILT
WGVWDTPHRTAATPKAGDALATGPLLFGKDGSIKEASWAALHALRSSPDLR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaatcgcggcagacggcgaggtcgtttggcgctataaaaaagcaggggccggg
ccaacgtggccggaatattgcccactggaatccggaggcatcgtggcgctacgtcttacc
gataccgtctttacctcaacctcgccatgccgacgccggtttctgaaaagcagcgcggcg
ctgatgctggcgggcgcgctgccgttgccagttctggcatccatcccaccttttcccgcc
cttaaaactgttgcggcgcaaagtcatcggctgtttggctttgccgtcaggcccgacagt
ctgcaatccgatgcgcactatcggcagtttgtggcgagtcaggcgagcattatcgtgccg
gaaaatgcgctgaaatggatggccgtccatcccgcgcgcgatcgctacgatttcgccggg
cccgatgcgatcgccgcctttgcccgcgagcaggggataaggcttcgcgggcatacgttt
tgctggcaccgcgccctgccggactgggtacaggctattgctgatgaggctgagctggag
aaggttttgaggcagcatatagcgaccgttgcgggccgctaccgcgggcagattcacagt
tgggacgtggctaacgaaatcatcaatctcgccgacggacaacctggtggatggcgcaac
agtttctggtatcagcggcttggtacgcgttatatggatattgcctgcgaggcgctgcac
caggccgatccccatgcggtcatctgttacaacgattacgggctggaaagtgacgatgtg
agtgggcaaaggaaacgggcggcggtactggctatgctgcgcgacttgcagtccagacat
attccgattggcgcgctcggcatccagtctcatctcaaagccggtccccatcccgctttt
gggccggggctggcggcatttattcacgacgtgaaatcgcttggcctgaaggtgtacatc
accgaactggacgtggatgacagcagcgtgccgatggagagccggccgatggcggttgcc
gcgctgtataaacgctatctttcactggttctggaggcgggcgttgccgccattttaacg
tggggcgtttgggatacgccgcaccgcacggctgcgacaccgaaggcgggggacgcgctg
gcgaccgggccgctgctgtttggtaaagacggcagcattaaagaggccagttgggcggcg
ctgcacgcgctccgctcatcaccggatctcagatga

DBGET integrated database retrieval system