KEGG   Pantoea ananatis LMG 20103: PANA_0452Help
Entry
PANA_0452         CDS       T01195                                 

Gene name
folP
Definition
FolP
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PANA_0452 (folP)
Enzymes [BR:pam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PANA_0452 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
522018..522875
Genome map
AA seq 285 aa AA seqDB search
MRYKEYITMKLFARDSHLDLSFPHVMGILNVTPDSFSDGGKHNALVDALTHTNEMVNAGA
TIIDVGGESTRPGADEVSVEEELERVIPVVAAIAQRFEVWISVDTSKAEVIREAASVGAH
IINDVRSLSEPGALAAAAATGLPVCLMHMKGEPRTMQQAPAYQDIFSEVDAYFVEQLARC
EAAGIKKENLLLDPGFGFGKNLSHNYELLARLGEFHHFGLPLLVGMSRKSMIGQLLNVGP
GQRLTGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATQRAKG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
ttgcgctacaaggagtacatcaccatgaaattgttcgcccgtgattcccatcttgatttg
tcgtttccacatgtgatgggcattcttaacgtcacgccggactctttttcggatggtggt
aaacacaatgcgttggtggatgcactcacgcataccaatgaaatggtgaatgccggcgca
accattatcgacgtgggaggcgagtctacgcgtcccggcgcggatgaggtcagcgttgag
gaagaacttgagcgggtcatccccgtggtggcagcaatcgctcagcgctttgaagtctgg
atctccgtggatacctctaaggctgaggtcatcagggaagcggcgagcgtgggggcgcac
atcatcaatgacgtgcgctctctgtctgaaccaggagcgctggccgccgccgccgcgact
ggcctgccggtatgcctgatgcatatgaagggcgagccgcgcaccatgcagcaggcaccg
gcctatcaagatatcttcagcgaagtggatgcttacttcgttgagcaactggcccgctgc
gaggcggccggaataaaaaaagagaatctgctgctcgacccgggcttcggtttcggtaag
aatctcagccacaattatgaactgttggctcgactcggcgaatttcaccattttggtctg
cccctgctggttggcatgtcacgaaaatcaatgattggtcagcttctgaatgtcgggcct
ggccagcgtctgaccggcagcctggcctgcgcggtgatcgccgccatgcagggagcacac
attattcgcgttcatgatgtaaaagaaacggtcgaggcgatgcgggtggtcgaggcgaca
caaagagctaaaggatga

DBGET integrated database retrieval system