KEGG   Pantoea ananatis LMG 20103: PANA_0475Help
Entry
PANA_0475         CDS       T01195                                 

Gene name
nahA
Definition
NahA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pam00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pam00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546551..548932
Genome map
AA seq 793 aa AA seqDB search
MPMPLRRNVLICCCALTFSAAADTLPLMPWPQQVEQPAHAGWLTLTPQLTLQIVGDTLPG
AETRWLSRIARQTGWPLLPADQPVEHPTIRIAIAQAVNPVPQPDSDESYQLDVNRDGVLL
KANSRFGAMRGMETLLQLIENSAEGTRIPWITIHDKPRFAWRGILIDSARHFMPVRTLKR
QIDGIAAARMNVLHWHLTDDQGWRFASLRYPQLQQKASDGLFYTQAEMREVVQYAAERGV
RVVPELDIPGHASALAVAMPELISAPGPYQMERGWGVFKPLLDPSNEQVYQVIDALVGEM
AAIFPDPYLHIGGDEVDPSQWQASAAVQQFMRDRGLADPHALQAWFNQRVEKILEKHQRR
MVGWDEIAHPDLPHSILIQSWQGQDALGTVAKNGYRGILSTGFYLDQPQPASYHYRNEIY
PQGLNGKDVVQSGEQAQSWSFTMPRLKGSPVTGSFTLIKGRDGWRGFIDFAGKSRRLVNA
IDWLSANRLTFTVDTWMGPFKPVVTLANNQLSGYMLVGNVRYAAEGQRLDAVPKGIQPVL
PDARQMQQNLLGGEAALWAENVNSAIIDTKLWPRAFVVAERLWSAQDVTDPDSMYQRLAA
MDRWTTVSVGLQQHYQADRQMTRLANSTDIQPLRVLAQALEPAQYYTRQHLKFQAGHYNY
FEPLNRLADVLPAESDAVRTLDKQVVALVEDRSNVAAAAAIRSQLQRWHDNAAQVAPLLN
GSAPLKALESSAKQVDELSVMGINMVNAYVRNQAFGASEMAQMHAKLDAAAQVQDETVIA
LVRPLEALLRAFK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
gtgccaatgccgttacgtcgaaatgtgctgatctgttgttgtgcgctgaccttttccgcc
gccgccgatacgctgccgctcatgccgtggccacagcaggttgagcaacctgcccacgca
ggctggctgacgctcaccccacagctgacgctacagattgtcggggacacgctgcccggc
gccgaaacacgctggctgtcgcgcatcgctcgccaaaccggctggccgctgttacccgcc
gatcagccggttgagcatcccacaattcgtattgccatcgcgcaggcggtcaaccctgtc
cctcagcctgacagcgatgaaagttaccaactggacgtcaaccgcgacggcgtgctgctg
aaagccaacagccgctttggcgcgatgcgcggcatggaaacgttactgcaactgatagaa
aacagtgccgaaggcacccgtattccctggataacaattcacgataaaccgcgctttgcc
tggcgcggcatccttatcgacagcgcccgccattttatgccggtcagaacgctgaaacgc
cagatcgatgggatcgcggcggcgcgaatgaacgtgctgcactggcatctcaccgacgat
cagggctggcgctttgcctccctccgctatccgcaactgcagcagaaagccagcgacggg
cttttctacactcaggcggagatgcgtgaggtggtgcagtatgcggctgagcgtggcgtg
cgcgtggtgccggagctggatatacccggccatgcctccgcgctggcggtggcgatgccg
gaactgatcagcgcgccggggccgtatcagatggaacgcgggtggggcgttttcaaaccc
ttgctggatcccagcaacgaacaggtttatcaggttattgacgcgctggtgggggaaatg
gcggcgatcttccccgatccctacctgcatatcggcggcgatgaggtggaccccagccag
tggcaggcatccgccgctgttcagcagtttatgcgcgatcgtggattagccgatccccat
gcgctgcaggcctggttcaatcagcgcgttgagaaaatcctcgaaaaacaccagcggcgc
atggtgggctgggatgaaattgcccatcccgatctgccgcacagcattctgattcagtcc
tggcagggacaggatgcactgggcacggtagcgaaaaacggctatcgcggcattctgtcc
acgggtttttatctcgatcagcctcagccggccagctatcactatcgcaacgaaatctat
cctcagggccttaacggcaaagatgtggtgcagtcgggcgaacaggctcagagctggtcc
tttaccatgccgcggttaaaaggcagcccggtaacggggagtttcaccctgattaaaggc
cgcgacggctggcgcggttttatcgactttgccggaaaatcgcgtcgtctggtgaacgcc
atcgactggctttcggcgaaccggctgacgttcacggtggatacctggatgggaccgttc
aaaccggtcgtcaccctggcgaacaatcaactgagcggatacatgctggtgggtaacgtc
cgttacgcggccgaagggcagcggctcgacgcggtgcccaaggggattcagcctgtgctg
ccggatgcgcgccagatgcagcaaaacctgctgggcggtgaggccgcgctgtgggccgaa
aacgtcaacagcgcgattattgataccaaactctggccgcgtgcgtttgtggtggcggag
cggttatggtcagcccaggatgtcaccgatcccgacagcatgtaccagcggctggcggca
atggaccgctggacgaccgtatcggtggggctgcagcagcattatcaggcagaccgacag
atgacgcggcttgcaaacagcacggatattcagccgctgcgcgtgctggctcaggcgctg
gaaccggcccagtattacactcgacagcatctcaagtttcaggccggacattacaactac
tttgagccgctgaaccggctggccgatgttttaccggcagaaagcgacgccgtcagaaca
ctggataagcaggtggtcgcgctggttgaagacagaagcaacgtggcggctgccgcagct
attcgctctcaactccaacgctggcacgataacgctgctcaggttgcgccattactcaac
ggcagcgcgccacttaaggcgctggaaagcagcgcgaaacaggtggatgagctgagcgtc
atgggcatcaacatggtgaatgcctatgtccgtaaccaggcgtttggggccagcgaaatg
gcgcaaatgcatgcgaagctggatgcggcggcgcaggtgcaggacgaaaccgtcatcgcc
cttgtcaggcctcttgaggccctcctccgcgccttcaaatga

DBGET integrated database retrieval system