KEGG   Pantoea ananatis LMG 20103: PANA_0475Help
Entry
PANA_0475         CDS       T01195                                 

Gene name
nahA
Definition
NahA
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_0475 (nahA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PANA_0475 (nahA)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PANA_0475 (nahA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
546551..548932
Genome map
AA seq 793 aa AA seqDB search
MPMPLRRNVLICCCALTFSAAADTLPLMPWPQQVEQPAHAGWLTLTPQLTLQIVGDTLPG
AETRWLSRIARQTGWPLLPADQPVEHPTIRIAIAQAVNPVPQPDSDESYQLDVNRDGVLL
KANSRFGAMRGMETLLQLIENSAEGTRIPWITIHDKPRFAWRGILIDSARHFMPVRTLKR
QIDGIAAARMNVLHWHLTDDQGWRFASLRYPQLQQKASDGLFYTQAEMREVVQYAAERGV
RVVPELDIPGHASALAVAMPELISAPGPYQMERGWGVFKPLLDPSNEQVYQVIDALVGEM
AAIFPDPYLHIGGDEVDPSQWQASAAVQQFMRDRGLADPHALQAWFNQRVEKILEKHQRR
MVGWDEIAHPDLPHSILIQSWQGQDALGTVAKNGYRGILSTGFYLDQPQPASYHYRNEIY
PQGLNGKDVVQSGEQAQSWSFTMPRLKGSPVTGSFTLIKGRDGWRGFIDFAGKSRRLVNA
IDWLSANRLTFTVDTWMGPFKPVVTLANNQLSGYMLVGNVRYAAEGQRLDAVPKGIQPVL
PDARQMQQNLLGGEAALWAENVNSAIIDTKLWPRAFVVAERLWSAQDVTDPDSMYQRLAA
MDRWTTVSVGLQQHYQADRQMTRLANSTDIQPLRVLAQALEPAQYYTRQHLKFQAGHYNY
FEPLNRLADVLPAESDAVRTLDKQVVALVEDRSNVAAAAAIRSQLQRWHDNAAQVAPLLN
GSAPLKALESSAKQVDELSVMGINMVNAYVRNQAFGASEMAQMHAKLDAAAQVQDETVIA
LVRPLEALLRAFK
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
gtgccaatgccgttacgtcgaaatgtgctgatctgttgttgtgcgctgaccttttccgcc
gccgccgatacgctgccgctcatgccgtggccacagcaggttgagcaacctgcccacgca
ggctggctgacgctcaccccacagctgacgctacagattgtcggggacacgctgcccggc
gccgaaacacgctggctgtcgcgcatcgctcgccaaaccggctggccgctgttacccgcc
gatcagccggttgagcatcccacaattcgtattgccatcgcgcaggcggtcaaccctgtc
cctcagcctgacagcgatgaaagttaccaactggacgtcaaccgcgacggcgtgctgctg
aaagccaacagccgctttggcgcgatgcgcggcatggaaacgttactgcaactgatagaa
aacagtgccgaaggcacccgtattccctggataacaattcacgataaaccgcgctttgcc
tggcgcggcatccttatcgacagcgcccgccattttatgccggtcagaacgctgaaacgc
cagatcgatgggatcgcggcggcgcgaatgaacgtgctgcactggcatctcaccgacgat
cagggctggcgctttgcctccctccgctatccgcaactgcagcagaaagccagcgacggg
cttttctacactcaggcggagatgcgtgaggtggtgcagtatgcggctgagcgtggcgtg
cgcgtggtgccggagctggatatacccggccatgcctccgcgctggcggtggcgatgccg
gaactgatcagcgcgccggggccgtatcagatggaacgcgggtggggcgttttcaaaccc
ttgctggatcccagcaacgaacaggtttatcaggttattgacgcgctggtgggggaaatg
gcggcgatcttccccgatccctacctgcatatcggcggcgatgaggtggaccccagccag
tggcaggcatccgccgctgttcagcagtttatgcgcgatcgtggattagccgatccccat
gcgctgcaggcctggttcaatcagcgcgttgagaaaatcctcgaaaaacaccagcggcgc
atggtgggctgggatgaaattgcccatcccgatctgccgcacagcattctgattcagtcc
tggcagggacaggatgcactgggcacggtagcgaaaaacggctatcgcggcattctgtcc
acgggtttttatctcgatcagcctcagccggccagctatcactatcgcaacgaaatctat
cctcagggccttaacggcaaagatgtggtgcagtcgggcgaacaggctcagagctggtcc
tttaccatgccgcggttaaaaggcagcccggtaacggggagtttcaccctgattaaaggc
cgcgacggctggcgcggttttatcgactttgccggaaaatcgcgtcgtctggtgaacgcc
atcgactggctttcggcgaaccggctgacgttcacggtggatacctggatgggaccgttc
aaaccggtcgtcaccctggcgaacaatcaactgagcggatacatgctggtgggtaacgtc
cgttacgcggccgaagggcagcggctcgacgcggtgcccaaggggattcagcctgtgctg
ccggatgcgcgccagatgcagcaaaacctgctgggcggtgaggccgcgctgtgggccgaa
aacgtcaacagcgcgattattgataccaaactctggccgcgtgcgtttgtggtggcggag
cggttatggtcagcccaggatgtcaccgatcccgacagcatgtaccagcggctggcggca
atggaccgctggacgaccgtatcggtggggctgcagcagcattatcaggcagaccgacag
atgacgcggcttgcaaacagcacggatattcagccgctgcgcgtgctggctcaggcgctg
gaaccggcccagtattacactcgacagcatctcaagtttcaggccggacattacaactac
tttgagccgctgaaccggctggccgatgttttaccggcagaaagcgacgccgtcagaaca
ctggataagcaggtggtcgcgctggttgaagacagaagcaacgtggcggctgccgcagct
attcgctctcaactccaacgctggcacgataacgctgctcaggttgcgccattactcaac
ggcagcgcgccacttaaggcgctggaaagcagcgcgaaacaggtggatgagctgagcgtc
atgggcatcaacatggtgaatgcctatgtccgtaaccaggcgtttggggccagcgaaatg
gcgcaaatgcatgcgaagctggatgcggcggcgcaggtgcaggacgaaaccgtcatcgcc
cttgtcaggcctcttgaggccctcctccgcgccttcaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system