KEGG   Pantoea ananatis LMG 20103: PANA_0614Help
Entry
PANA_0614         CDS       T01195                                 

Gene name
holD
Definition
(GenBank) HolD
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00230  Purine metabolism
pam00240  Pyrimidine metabolism
pam01100  Metabolic pathways
pam03030  DNA replication
pam03430  Mismatch repair
pam03440  Homologous recombination
Module
pam_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PANA_0614 (holD)
   00240 Pyrimidine metabolism
    PANA_0614 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PANA_0614 (holD)
   03430 Mismatch repair
    PANA_0614 (holD)
   03440 Homologous recombination
    PANA_0614 (holD)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PANA_0614 (holD)
DNA replication proteins [BR:pam03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PANA_0614 (holD)
DNA repair and recombination proteins [BR:pam03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     PANA_0614 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi G2F CSTF_C
Motif
Other DBs
NCBI-ProteinID: ADD75781
UniProt: D4GJH1
Position
707703..708113
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWLLQQMGITQYQLRRPRVLQGEIAVRLLPDTQLIIVAENPPGLQEPILRDVLHT
LSLKPTQVMTVTPDQLQMLPETLNCAGWLLGVESEQTFNGVALTSASFNELLSSGAARRA
LWQQMCEHDSHFFPHA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacgtccaggcgcgactggcttttacagcaaatggggattacgcagtatcaactgcgc
cgcccgcgcgtgctccagggcgagatcgccgtacggcttttgccggatacgcagctgatt
attgtggcggagaatccgccaggtttgcaggaacccatcctgcgtgatgtcctgcacacg
ctcagtcttaaaccgacgcaggtgatgactgtgacgcctgaccagctgcaaatgctgccg
gaaacgctcaactgcgcgggctggctattgggcgttgagagcgaacaaacctttaatggc
gttgccttaaccagcgcttcttttaatgaactgcttagcagcggtgccgcccggcgcgcg
ctctggcaacagatgtgtgaacatgacagccatttctttcctcacgcctga

DBGET integrated database retrieval system