KEGG   Pantoea ananatis LMG 20103: PANA_0632Help
Entry
PANA_0632         CDS       T01195                                 

Gene name
rbkS
Definition
(RefSeq) RbkS
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA_0632 (rbkS)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PANA_0632 (rbkS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726780..727697
Genome map
AA seq 305 aa AA seqDB search
MDIAVIGSNMVDLITYTNSFPKAGETLEAPDFAIGCGGKGANQAVAAAKLGGEVMLVSKV
GDDLFAPTTLANLQQQGVDTRYVTTEKGVSSGVAPIFVDDQSQNRILIIKGANQHLKPAD
IDAAGDALKRCRLIILQLEIPLETVYYAIDFARQHDIRVILNPAPAVADLDIRYACQCDF
FMPNETELEILTGMPVGTDDDVRLAGASLLKRGLKNLIVTLGSRGSLWMTGETQHQVAPV
PVKAVDTSGAGDAFIGCFAHELVKTGDIPAAMAKASAYAACSVTARGTQRSYPDTAEFQR
FLDLQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgccgttattggttcaaacatggtggatttaatcacctataccaacagcttt
cctaaagctggagagacgcttgaggcacccgattttgcgattggctgtgggggaaaaggg
gccaatcaggctgtggcggcagcaaaactgggtggcgaggtgatgctggtcagtaaagtc
ggcgatgacctgtttgcgcccaccacgttggctaatttgcaacagcagggcgtggatacg
cgttatgtcacaaccgaaaaaggggtttccagcggcgtggcccccatttttgttgatgat
cagtcgcaaaaccgcattttaattatcaaaggcgcgaatcagcacctcaagccggcggat
attgatgctgcgggtgatgcgttgaaacgctgtcggttgatcattcttcagctcgaaatt
ccgctggaaacggtgtactacgctatcgattttgcccgtcagcatgatattcgcgtcatc
ctcaaccctgcgcccgccgtggcagacctggatatccgctatgcctgccagtgcgacttt
tttatgcccaatgagacggagctggaaattcttaccgggatgccggtggggacggatgat
gacgtcaggctggccggtgcatccttgctgaaacgtggcctgaaaaacctgatcgttacg
ctgggcagtcgcggatcgttgtggatgaccggagagacacagcaccaggttgcgcctgtg
ccggttaaggcagtggataccagcggtgcgggtgatgcgtttatcggctgcttcgctcat
gaactggtgaaaacgggcgatattcctgcggcgatggccaaagcctccgcctacgcggcc
tgtagcgtgacggcgcgcggcacacaacgttcttatcctgatacagcggaatttcagcgc
tttcttgaccttcagtga

DBGET integrated database retrieval system