KEGG   Pantoea ananatis LMG 20103: PANA_0657Help
Entry
PANA_0657         CDS       T01195                                 

Gene name
thrC
Definition
ThrC
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PANA_0657 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_0657 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PANA_0657 (thrC)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PANA_0657 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762483..763766
Genome map
AA seq 427 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVKQGLGSQQGLFFPLELPEFELTDIDAMLEMDFVTRSSKILS
AYIGDEIPAAHLTERLKTAFTFPAPVKAVSDDIACLELFHGPTLAFKDFGGRFMAQMLSY
VSGSDEQITILTATSGDTGAAVAHAFYGMENVRVVILYPQGKISPLQEKLFCTLGGNIET
IAIDGDFDACQSLVKQAFDDQALKKAIGLNSANSINISRLLAQICYYFEAVAQLPQEKRN
QLVVSVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRFLGKGEWQPNATVATLSN
AMDVSQPNNWPRVEELFRRKTWRLSDLAYGAVTDDVTREAMRELAKLGYVSEPHAAIAWR
LLRDQLQEGEFGLFLGTAHPAKFLESVESILDQKLALPAELAERADLPLLSHQMGADFAQ
LRAFLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctacaaccttaaggatcataacgagcaggtcagcttcgcccaggcggtgaaa
caaggtctgggttcacagcaagggctgttttttccgctcgaactgccggaatttgaactg
accgacatcgatgccatgctggaaatggattttgttacccgcagcagtaaaatcctttca
gcctatatcggggatgaaatcccggcagcgcacctgactgaacgcctgaaaaccgcgttc
accttcccggcgccggttaaggccgtcagcgacgacattgcctgcctggagttgttccac
ggcccgacgctggcgttcaaagattttggcggccgcttcatggcgcagatgctgtcatac
gtcagcgggtccgatgagcaaattaccattctgacggcgacgtccggcgataccggtgct
gccgtggctcacgccttttacggtatggagaatgtgcgtgttgtcatcctctatccgcag
gggaaaatcagcccgttacaggagaagttgttctgcacgctgggcggcaacatcgaaacc
attgcgattgacggcgattttgacgcctgccagtcgctggttaagcaggcgtttgacgat
caggcgctgaaaaaggcgatcggcctgaactccgctaactcgattaacatcagccgcctg
ctggcgcagatttgctactactttgaagcggttgcccaactgccgcaggagaagcgtaat
cagctggtggtctccgtgccaagcggaaactttggtgatttaacggccggcctgctggcg
aaatcactgggtctgccgattaaacgctttatcgccgcgaccaacgccaacgatacggtg
ccacgtttcctgggcaagggtgaatggcagcctaacgccaccgtggcgacgctgtcgaat
gctatggacgttagccagccaaacaactggccgcgtgtggaagagctgttccgccgcaaa
acctggcgtctgagcgatctggcttacggtgcggtaacggacgatgttacgcgtgaagcg
atgcgcgagctggcgaagctgggttacgtctctgagccgcatgcggcaattgcctggcgt
ctgttgcgtgaccagctgcaggaaggggagtttggtttattcctcggaacggcccatccg
gctaagttcctggagagcgtggaaagcattctggatcagaaactggcattgcctgccgag
ctggctgagcgcgcggatctgcccctgctgtcgcatcagatgggcgcagattttgcccaa
ctacgggcgtttctgctcaagtaa

DBGET integrated database retrieval system