KEGG   Pantoea ananatis LMG 20103: PANA_0680Help
Entry
PANA_0680         CDS       T01195                                 

Gene name
folA
Definition
FolA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PANA_0680 (folA)
   00670 One carbon pool by folate
    PANA_0680 (folA)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PANA_0680 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
791434..791949
Genome map
AA seq 171 aa AA seqDB search
MAPVFFSEPFNMISLIAALAADRIIGMENAMPWDLPADLAWFKRNTLKKPVIMGRLTFES
IGRPLPGRLNIVVSSKPGSAEGVTWVTSLDDAISAAGEAEEIMVIGGGRIYEQMLARADR
LYLTHIDAEVEGDTQFPDYEPDEWHSTFSEFHDADEQNSHSYCFEILERRR
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctgtttttttcagcgagccttttaacatgattagtcttatcgcggcattagca
gcagatcgcattattggaatggaaaacgccatgccgtgggacctgcctgcagacctggcg
tggtttaagcgcaacacactgaaaaagccagttattatgggcagactgacctttgaatct
attggtcgtccattgcctggccggctcaacattgtggtcagcagcaagccgggcagtgcc
gaaggcgtaacctgggtaacttcgctggacgacgccatcagtgcggcgggtgaggctgaa
gagatcatggtcattggcggcggccgcatctatgagcagatgctggcgcgcgccgaccgt
ctttatctgacgcacattgatgcggaagtggaaggcgatacacagttcccggattacgag
ccggatgagtggcactccacgttcagtgagtttcatgatgccgatgagcagaactcgcac
agttactgctttgagatcctcgaacgccgccgttaa

DBGET integrated database retrieval system