KEGG   Pantoea ananatis LMG 20103: PANA_0714Help
Entry
PANA_0714         CDS       T01195                                 

Gene name
murE
Definition
MurE
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    PANA_0714 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PANA_0714 (murE)
Enzymes [BR:pam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     PANA_0714 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834210..835709
Genome map
AA seq 499 aa AA seqDB search
MRNQVTDRNLRDLLGPWVPDAPARPLRDMTLDSRLAAAGDLFVAIAGHQVDGRRFIPQAI
AQGVAAVIAEAEGEASDGEIREMHGVPVIYLAQLHQRLSALAGRFYQQPGEKQKLIGVTG
TNGKTTTTQLLAQWASLLGETSAVMGTVGNGLVGQLVPAENTTGSAVDVQHNLDELVRKG
ASLTAMEISSHGLVQHRVAALPFAAAVFTNLSRDHLDYHGDMQQYESAKWLLFSEHQVGV
AIINADDEVGRRWLANLPDAVAVTMENNLQPGCHGRWLRATDVNYHDNGAHIRFDSSWGE
GEMNSRLMGAFNVSNLLLALATLLALGYALDDLLRVAARLQPVNGRMEVFSATGKPTVVV
DYAHTPDALEKALEAARLHCKGKLWCLFGCGGDRDKGKRPLMGAIAEQFADIVVVTDDNP
RSEDPQAIVQDILSGLLDPGRARVVAGRAQAVTSTIMQAQPDDIVLVAGKGHEDYQIIGN
QRLDYSDRATVATLLGGVA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaatcaagtgacagatcgtaacctgcgcgacttactcggaccgtgggtgcctgac
gcacccgcgcgcccgttgcgtgacatgactctggacagtcgcttagcggctgcaggtgat
ctgtttgtagcaattgcaggccatcaggttgacggacgccggtttattcctcaggcaatt
gcgcagggcgtggcggccgttatcgcggaagcggaaggggaagcaagcgacggtgaaatt
cgggagatgcacggcgtaccggtgatttatctggcgcaactgcatcagcgcctttctgcc
ctggcaggccgtttttaccagcagccgggcgaaaagcagaaactgattggcgtgaccggt
acgaacggcaaaaccacgaccacacagctgctggcgcagtgggccagcctgctgggtgaa
accagcgcggtgatggggaccgtcggcaatggtctggtcgggcaactggtcccggccgaa
aacaccaccggttcagcggtggatgtgcaacataacctggacgaactggtcaggaagggc
gcatcgctgacggcaatggaaatttcctcgcacgggctagtacagcatcgggtcgcagcg
ctgccgtttgccgctgccgtctttacgaatctcagtcgcgaccatcttgattatcacggt
gacatgcagcagtacgagtccgctaaatggctgctgttttccgaacatcaggtcggtgtg
gccattatcaatgctgacgatgaggtcggtcgccgctggctggcaaacctgccagacgct
gtggccgtcacgatggaaaataatctgcagcccggctgtcatggccgctggcttcgtgcg
actgacgtgaattatcacgacaatggtgcgcacattcgttttgactccagctggggcgag
ggcgaaatgaacagtcgcctgatgggcgccttcaacgtcagcaatttactgctggcgctg
gcgacgctgctggcgctgggctacgccctggacgatctgctgcgcgtagcggcaagactg
cagccggtgaacggacgcatggaggtctttagcgccaccggtaaacccaccgtggtagtg
gattatgcccatacgccagatgcattagagaaagcgctcgaagcggcgcggctgcattgc
aaaggcaaactatggtgcctgtttggatgtggcggcgatcgtgataaaggtaagcgccca
ctaatgggagcgatcgctgagcaatttgccgacatcgtggtggtgacagatgataaccca
cgaagcgaagatccgcaggccatcgtacaggatattctgagtgggctgcttgaccctggc
cgtgcccgcgtggtcgccggtcgggcgcaggccgtgaccagcaccattatgcaggcccag
cccgatgatatcgtactggtggctggaaaaggtcacgaagactatcaaattattggcaat
caacgcctggattactccgatcgtgccacggtcgccacactgctaggaggcgtagcatga

DBGET integrated database retrieval system