KEGG   Pantoea ananatis LMG 20103: PANA_0744Help
Entry
PANA_0744         CDS       T01195                                 

Gene name
aceF
Definition
(GenBank) AceF
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00020  Citrate cycle (TCA cycle)
pam00620  Pyruvate metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
Module
pam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_0744 (aceF)
   00020 Citrate cycle (TCA cycle)
    PANA_0744 (aceF)
   00620 Pyruvate metabolism
    PANA_0744 (aceF)
Enzymes [BR:pam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PANA_0744 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: ADD75911
UniProt: D4GK82
Position
869189..871087
Genome map
AA seq 632 aa AA seqDB search
MAIEIKVPDIGSDEVEVTEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
TGDKVETGSLIMMFDAEGAAEAAPAPAQEKKAEAAPAAAPASASKDVNVPDIGGDEVEVT
EILVKVGDKVEAEQSLIVVEGDKASMEVPAPFAGVVKEITIATGDKVSTGSAIMVFEAEG
AAPASDAKPDVKEEAASAPAAAAGAKDVNVPDIGGDEVEVTEILVKVGDKVEAEQSLIVV
EGDKASMEVPAPFAGIVKELKVATGDKVSTGSLIMVFEVEGAAPAAPAAAKQEAAPAPAA
KSEAKAAAAPAAAKTESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILKE
DVQAYVKDAVKRAEAAPAAASGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSR
NWVMIPHVTHFDKTDITELEAFRKQQNAEAEKRKLDVKYTPVVFIMKAVAAALEQMPRFN
SSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGITELSRELMAISKKARDGKL
TAGDMQGGCFTISSLGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFAPRLMMPIS
LSFDHRVIDGADGARFITIIGNMLSDIRRLVM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcaaggtaccagatatcgggtcagacgaagttgaagtcaccgaaatt
ctggtcaaggttggcgacaaggtggaagccgagcagtcgctgatcaccgtggaaggcgat
aaagcctctatggaagttccctcgccgcaggctggcgtggtgaaagagatcaaaatcgca
accggtgacaaagtggaaaccggttcgctgatcatgatgtttgatgctgaaggcgctgcg
gaagcagcccctgcgcccgcgcaggagaaaaaagcagaggccgcgccagccgctgcacct
gccagtgccagcaaagacgttaacgtgccggacatcggcggtgacgaagttgaagtcact
gagattctggttaaggttggcgataaagtcgaagccgagcagtcacttattgtcgtcgaa
ggtgacaaagcgtcaatggaagttccggctccgttcgcgggtgtggtcaaagagatcacc
attgcgaccggcgacaaagtcagcaccggttcagccatcatggtctttgaagcagaaggt
gcagcaccggcctctgatgcgaagccagacgtgaaagaagaagcggcatcggcacctgcc
gcggctgcgggcgcaaaagacgttaacgttccggatatcgggggagacgaagttgaagtc
accgagatcctcgttaaggttggcgacaaggtggaagccgagcagtcactgatcgttgtt
gaaggcgacaaagcctctatggaagtgccagcaccgtttgcgggtatcgtcaaagagctg
aaagtcgcgacgggcgataaagtcagcaccggctcactgattatggtcttcgaagttgaa
ggtgctgctccggctgcccctgcggctgcgaaacaggaagccgcaccggcgcctgctgcc
aaatctgaagcgaaagccgcagcagcacctgccgccgctaaaacagagagcaaaggtgag
ttcgcagagaacgacgcttacgttcacgctaccccggtcattcgtcgtctggcgcgtgaa
tttggcgttaacctggccaaagttaaaggcacaggccgtaaaggtcgtattctgaaagaa
gacgttcaggcttacgttaaagatgccgtgaaacgcgcagaagccgcgccagccgccgcc
agcggtggcggcctgccgggcatgctgccatggccgaaggttgacttcagtaagtttggg
gaagttgaagaagtggagctgggccgtatccagaaaatctcaggtgcgaacctgagccgt
aactgggtcatgatcccacacgttacgcacttcgacaaaaccgatattaccgagcttgaa
gctttccgtaagcagcagaacgccgaagcggagaagcgtaagctggacgtgaaatacacg
ccagtggtcttcatcatgaaagcggtggcggcggcgcttgagcagatgccacgctttaac
agctcactgtctgaagatgcgcagaagctgacgctgaaaaagtacatcaacatcggtgtg
gcggtggatactccaaatggcctggtggttccggtctttaaagacgtgaacaagaagggc
atcacagaactgtctcgtgaactgatggcgatctctaaaaaggcgcgcgatggcaaacta
accgcaggcgacatgcagggcggctgtttcaccatctccagccttggcggcctgggcacc
acccactttgcgccgattgttaacgcgccagaagtggccatccttggtgtgtcaaagtca
gcgatggagccagtgtggaacggtaaagagtttgcaccacgtctgatgatgccaatctct
ctgtccttcgatcaccgcgttatcgacggtgcagatggcgcacgtttcattaccattatt
ggcaatatgctgtcagacattcgtcgtctggttatgtaa

DBGET integrated database retrieval system