KEGG   Pantoea ananatis LMG 20103: PANA_0873Help
Entry
PANA_0873         CDS       T01195                                 

Gene name
mtnD
Definition
MtnD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pam00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1010260..1010865
Genome map
AA seq 201 aa AA seqDB search
MMTAIIVRSPIFPRLTRSRFEMSALTIFSDSDPSQPIWHSTDAEAIRARLNAKDVRFERW
QADRDLGENPDAETVINAYQHAIDRLVAEKGYQSWDVISMRADNPQKDVLRQKFLSEHTH
GEDEVRFFVEGAGLFCLHLDGEILQILCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDN
QEGWIANFTGDKIADAYPRLA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatgacagccatcatcgtcaggtcgccgatttttcccagattaacccggagtcgattt
gagatgagtgcactgaccatttttagcgatagcgatcccagccagccgatatggcacagc
accgatgctgaggcgattcgcgcgcggctgaatgccaaagacgtccgttttgaacgctgg
caggccgaccgcgatctgggcgaaaacccggatgcggaaacggtcatcaacgcctatcag
catgccatcgaccggctggtggccgaaaaaggctatcagagctgggacgtgattagcatg
cgtgccgataacccgcagaaggacgttctgcgccagaagtttctgtcggaacacacgcac
ggcgaagatgaagtgcgcttctttgtcgagggtgcggggctgttttgtctgcatctggac
ggtgaaattttgcagatcctgtgcgaaaagaacgatctgatttcggtgcccgccggcacg
ccgcactggtttgatatgggatcgtccccgcacttcaccgcgattcgcatttttgataat
caggaaggctggatcgccaatttcaccggcgacaagattgccgatgcctatccgcgcctt
gcgtaa

DBGET integrated database retrieval system