KEGG   Pantoea ananatis LMG 20103: PANA_0892Help
Entry
PANA_0892         CDS       T01195                                 

Gene name
proB
Definition
ProB
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PANA_0892 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PANA_0892 (proB)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     PANA_0892 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1032866..1034056
Genome map
AA seq 396 aa AA seqDB search
MQFFPYWLLASLTAPVKKSVHRNFLRQDNMSGSQTLVVKLGTSVLTGGSRRLNRAHMVEL
VRQCAQQHAAGHRIVIVTSGAMAAGREHLGYPELPPTIASKQLLAAVGQSRLIQLWEQLF
SIYGIHIGQMLLTRADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDN
LSALAAMLGGADKLLLLTDQPGLFTADPRNNPEAELISDVHIIDDALRALAGGSVSGLGT
GGMSTKLQAADVACRAGIDVIIAAGSRSGVISDVIAGKPVGTLFHAQQTPLENRKRWIFG
APPAGEITVDDGALAAIIERGSSLLPKGIREIQGNFSRGEVIRIRSLQGRDIAHGVSRYN
SDAMRMIAGHHSQQISEILGYEYGPVAVHRDDMIVS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
ttgcagtttttcccttactggctgttggcttccctcactgcacctgttaaaaagtcggtt
cacagaaattttttacggcaggacaacatgagtggcagtcagacccttgtggtcaaattg
ggtaccagcgttcttaccggcggatcgcgtcggttaaacagagcgcacatggtggaatta
gtgcgtcagtgcgcgcaacagcacgccgccggccatcgtattgtgattgtgacctccggc
gcgatggcggccggtcgtgagcatctggggtaccccgaactgccgcctaccatcgcctca
aagcagctgctagctgcggtggggcaaagtcgtcttattcaactgtgggaacagctgttt
tccatctacggcattcatatcggtcagatgttactgactcgcgccgatatggaggatcgt
gaacgctttcttaatgcgcgcgatactttgcgtgccttgctggataacaacatcgtgccc
gtcatcaatgaaaatgacgcggttgccaccgctgaaatcaaagtgggtgacaatgacaac
ctgtctgcgctggcagccatgctgggtggggcagacaagctgctcttactgaccgaccag
ccggggctgtttactgccgatccgcgtaataatccagaggcggaattaatcagcgatgtg
catattatcgatgatgcgttgcgcgccttagcgggcggcagcgtgtccggactgggaacg
ggcggaatgtcgaccaaactgcaggccgcagacgttgcctgccgcgccggtatcgatgtg
attattgctgcaggcagccgcagcggcgtcattagcgatgtcattgcgggcaagccggtg
ggcaccctgtttcatgcgcagcaaacgccgcttgaaaaccgcaaacgctggatttttggt
gccccgccagcaggcgaaattaccgtggacgacggcgcgcttgccgccattatcgagcgc
ggcagctcactgctgccaaaaggtatccgcgagattcagggcaatttctcccgtggagaa
gtcatccgtatccgcagcctgcaggggcgcgatatcgcccacggcgtttcgcgctataac
agcgacgcgatgcgcatgatcgcagggcatcatagtcaacagataagcgaaattctgggc
tatgagtacgggccggttgcggtacatcgtgacgatatgatcgtcagctaa

DBGET integrated database retrieval system