KEGG   Pantoea ananatis LMG 20103: PANA_1031Help
Entry
PANA_1031         CDS       T01195                                 

Gene name
recR
Definition
RecR
Orthology
K06187  
recombination protein RecR
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PANA_1031 (recR)
DNA repair and recombination proteins [BR:pam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PANA_1031 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1180909..1181514
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMESLRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEICTICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
ADIGLDRLEQRLENETLHEVILATNPTVEGEATANYIAELCGQYGVDASRIAHGVPMGGE
LEMVDGTTLSHSLAGRQKIKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccctgctagagtctttaatggagtcgctgcgctgtttgccgggcgtt
gggcctaaatcggcccagcgtatggcgtttcaactgctacagcgcgatcggagtggcgga
atgcgtctggcgcaggccctgacccgggcgatgtcggaaatcggccactgtgccgattgc
cgcaccttcaccgagcaggaaatttgcaccatttgcgccaatccccggcgtcagcaaaat
ggtcaaatctgcgtggttgagagcccggcagacatccatgctattgagcaaaccgggcaa
tttgccggccgctatttcgtgttgatggggcatctttcgccgctggacggtattggtcca
gccgatattggtcttgaccgactggaacaacggctggaaaacgaaacgcttcacgaagtg
attctggcgaccaatcccacggttgaaggtgaagctaccgcgaactacatcgctgaattg
tgcggacagtatggcgtcgacgcgagccgtattgcgcatggggttccgatgggcggtgaa
ctggaaatggtcgatggcaccacgctgtcccactccctcgccggtcgtcaaaagattaaa
ttttaa

DBGET integrated database retrieval system