KEGG   Pantoea ananatis LMG 20103: PANA_1049Help
Entry
PANA_1049         CDS       T01195                                 

Gene name
tesA
Definition
TesA
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PANA_1049 (tesA)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PANA_1049 (tesA)
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PANA_1049 (tesA)
Lipid biosynthesis proteins [BR:pam01004]
 Fatty acid synthase
  Component type
   PANA_1049 (tesA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1200508..1201161)
Genome map
AA seq 217 aa AA seqDB search
MLSLTHGLSKMMNFKNVFRWHYPFLLLCCLLVSRLAAADTLLVLGDSLSAGYQMSASKAW
PSLLDKNWQQQPRVINASISGDTAAQGLARLPALLKQHQPQWVLIELGGNDGLRGFPPKD
IEQTLSTIIEQVKTARAKPILMQVRLPANYGRRYTDAFRAIYPQLAKQHDIPLLPFFMEQ
VYLKPEWMQQDGIHPNPDAQPFIAELMAKELAPLVKQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctccctgacccacggacttagtaagatgatgaacttcaagaatgttttccgctgg
cattatcctttcctgttattgtgctgtctgttggtgtcccgtcttgctgcggccgatacg
ttgctggtgctgggcgacagcctgagtgcaggctatcaaatgtcggccagtaaagcctgg
cccagcctgctcgataaaaactggcagcagcagcccagagtgattaatgccagtattagc
ggcgataccgccgcacaaggactggcgcgcttacctgccctattaaaacagcaccaaccg
cagtgggtgttaatcgaattgggcggtaacgacggcttacgtggctttccgccaaaggat
attgagcaaacgttaagcaccatcatcgagcaggtaaaaaccgccagggctaaaccgatc
ctgatgcaggtacgtttacccgccaactacggccgccgttatacggatgcgttccgcgcg
atttatccgcagttggcgaaacagcacgatattcctttactgccctttttcatggagcag
gtttatttaaaacccgaatggatgcagcaggatggtattcatcccaatcctgacgcccaa
ccctttatcgctgaactgatggcgaaagaactggccccattagttaagcagtag

DBGET integrated database retrieval system