KEGG   Pantoea ananatis LMG 20103: PANA_1049Help
Entry
PANA_1049         CDS       T01195                                 

Gene name
tesA
Definition
TesA
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pam01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1200508..1201161)
Genome map
AA seq 217 aa AA seqDB search
MLSLTHGLSKMMNFKNVFRWHYPFLLLCCLLVSRLAAADTLLVLGDSLSAGYQMSASKAW
PSLLDKNWQQQPRVINASISGDTAAQGLARLPALLKQHQPQWVLIELGGNDGLRGFPPKD
IEQTLSTIIEQVKTARAKPILMQVRLPANYGRRYTDAFRAIYPQLAKQHDIPLLPFFMEQ
VYLKPEWMQQDGIHPNPDAQPFIAELMAKELAPLVKQ
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctctccctgacccacggacttagtaagatgatgaacttcaagaatgttttccgctgg
cattatcctttcctgttattgtgctgtctgttggtgtcccgtcttgctgcggccgatacg
ttgctggtgctgggcgacagcctgagtgcaggctatcaaatgtcggccagtaaagcctgg
cccagcctgctcgataaaaactggcagcagcagcccagagtgattaatgccagtattagc
ggcgataccgccgcacaaggactggcgcgcttacctgccctattaaaacagcaccaaccg
cagtgggtgttaatcgaattgggcggtaacgacggcttacgtggctttccgccaaaggat
attgagcaaacgttaagcaccatcatcgagcaggtaaaaaccgccagggctaaaccgatc
ctgatgcaggtacgtttacccgccaactacggccgccgttatacggatgcgttccgcgcg
atttatccgcagttggcgaaacagcacgatattcctttactgccctttttcatggagcag
gtttatttaaaacccgaatggatgcagcaggatggtattcatcccaatcctgacgcccaa
ccctttatcgctgaactgatggcgaaagaactggccccattagttaagcagtag

DBGET integrated database retrieval system