KEGG   Pantoea ananatis LMG 20103: PANA_1200Help
Entry
PANA_1200         CDS       T01195                                 

Gene name
gpmA
Definition
(GenBank) GpmA
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00010  Glycolysis / Gluconeogenesis
pam00260  Glycine, serine and threonine metabolism
pam00680  Methane metabolism
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01120  Microbial metabolism in diverse environments
pam01130  Biosynthesis of antibiotics
pam01200  Carbon metabolism
pam01230  Biosynthesis of amino acids
Module
pam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pam_M00002  Glycolysis, core module involving three-carbon compounds
pam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1200 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    PANA_1200 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_1200 (gpmA)
Enzymes [BR:pam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PANA_1200 (gpmA)
Membrane trafficking [BR:pam04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    PANA_1200 (gpmA)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PANA_1200 (gpmA)
  Exosomal proteins of melanoma cells
   PANA_1200 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADD76367
UniProt: D4GMN2
Position
complement(1363918..1364670)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSDKGRTEAKAAGQLLKKEGFVFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWRLNERHYGALQGLDKAETAAKYGDEQVKQWRRGFA
VTPPELDRSDERFPGHDPRYASLKPEQLPTTESLALTIERVIPYWNESILPRIKSGEKVI
VAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggtgcgacacggcgaaagccagtggaacaacgaaaac
cgcttcaccggatggtatgatgtagacctttctgacaagggccgtaccgaagctaaagca
gccggacagctgctgaagaaagaaggtttcgtgtttgatttcgcctatacctctgtgctg
aaacgcgccattcacaccctgtggaatgtgctggatgagctggatcaggcctggctgccc
gttgagaaatcctggcgtctgaacgaacgtcactatggcgcgctgcagggcctggacaaa
gctgaaaccgccgcaaaatacggcgacgagcaggttaaacagtggcgtcgtggcttcgcg
gtgactccgccagagttggaccgcagcgatgagcgttttcctggacacgacccgcgttat
gcttcactgaagcctgagcagctgcccaccaccgaaagcctggcgctgaccatcgaacgc
gtgatcccttactggaacgaatccattctgccacgtatcaaaagtggtgagaaagtgatc
gtggcggcccacggtaactcactgcgtgcgctggtgaaatacctggacaacatgagcgaa
gaagagattcttgaactgaatatcccgaccggcgttccgctggtgtacgagttcgatgaa
aacttcaaaccgatcaaacattactacctgggtgatgctgacgagatcgcagcgaaagcc
gcggccgttgccaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system