KEGG   Pantoea ananatis LMG 20103: PANA_1497Help
Entry
PANA_1497         CDS       T01195                                 

Gene name
nagZ
Definition
NagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pam00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pam00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1683567..1684607
Genome map
AA seq 346 aa AA seqDB search
MTTGFPGPLMLDVEGFELDAEEREILRHPLVGGLILFARNYHDPAQLAELVRQIRAASPT
RLVVAVDQEGGRVQRFREGFTNLPAMQSFAALNDMTTAGELAQQAGWQMAAEMIALDIDI
SFAPVLDIGHISAAIGDRAFHEDPAIALAMARRFIAGMHEAGMKTTGKHFPGHGAVSADS
HKETPRDGRSEAELREHDMAIFRTLIGEQALDAIMPAHVIYTEADPLPASGSPYWLKTVL
RQELGFKGVIFSDDLSMEGAAVMGSYAERAQQSLSAGCDMILVCNDRQGAVSVIDNLTVI
EAEPVVQLYHRGTFSRDSLKASRRWKQNAQQLSALQERWLAHKATW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggtttccccggccccttgatgctggacgtcgaaggtttcgaactggatgcg
gaagagcgtgagatactgcgccatccgctggtgggtggattaatccttttcgcccgcaac
tatcatgaccccgctcaactggccgagctggtgcgtcagattcgtgccgcctcgcctacg
cgcctggtggtggcggtggatcaggagggcgggcgagtacagcgttttcgtgagggcttt
acgaatttgcccgctatgcagtcttttgccgcgctcaacgatatgacaacggcaggcgag
ctggcgcagcaggctggctggcagatggcggccgaaatgatcgcgctggatatcgatatc
agctttgcgccggtgctggatatcggccatatcagtgcggccataggcgatcgcgcgttc
catgaggaccctgcgattgccctggcgatggcgcggcgttttattgccggcatgcatgag
gccggaatgaaaaccaccggtaagcatttccccggtcacggcgcggtcagtgcagactcc
cacaaagagacaccgcgtgatggccgcagcgaagccgaactgcgcgagcatgatatggcg
atattccgcacgctgatcggcgagcaggcgctcgacgctattatgcccgcacacgtgatc
tatacggaagccgatccgctccccgccagcggttcaccttactggctgaaaacggtgtta
cgccaggagctgggtttcaagggcgtgattttctcggacgatctttcaatggaaggcgcg
gcggtgatgggcagctatgccgagcgtgcgcaacagtctctgtctgccggatgcgacatg
attctggtctgtaacgaccgtcagggcgcggtaagcgtgatcgataatttgaccgtgatc
gaggcagagccggtggtgcagttgtaccatcggggaacctttagccgggacagcctgaag
gccagtcgccgctggaaacagaatgcgcagcagttaagcgcgctgcaggaacgctggctg
gcgcataaagcgacgtggtaa

DBGET integrated database retrieval system