KEGG   Pantoea ananatis LMG 20103: PANA_1497Help
Entry
PANA_1497         CDS       T01195                                 

Gene name
nagZ
Definition
NagZ
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Module
beta-Lactam resistance, AmpC system
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PANA_1497 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PANA_1497 (nagZ)
Enzymes [BR:pam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PANA_1497 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1683567..1684607
Genome map
AA seq 346 aa AA seqDB search
MTTGFPGPLMLDVEGFELDAEEREILRHPLVGGLILFARNYHDPAQLAELVRQIRAASPT
RLVVAVDQEGGRVQRFREGFTNLPAMQSFAALNDMTTAGELAQQAGWQMAAEMIALDIDI
SFAPVLDIGHISAAIGDRAFHEDPAIALAMARRFIAGMHEAGMKTTGKHFPGHGAVSADS
HKETPRDGRSEAELREHDMAIFRTLIGEQALDAIMPAHVIYTEADPLPASGSPYWLKTVL
RQELGFKGVIFSDDLSMEGAAVMGSYAERAQQSLSAGCDMILVCNDRQGAVSVIDNLTVI
EAEPVVQLYHRGTFSRDSLKASRRWKQNAQQLSALQERWLAHKATW
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggtttccccggccccttgatgctggacgtcgaaggtttcgaactggatgcg
gaagagcgtgagatactgcgccatccgctggtgggtggattaatccttttcgcccgcaac
tatcatgaccccgctcaactggccgagctggtgcgtcagattcgtgccgcctcgcctacg
cgcctggtggtggcggtggatcaggagggcgggcgagtacagcgttttcgtgagggcttt
acgaatttgcccgctatgcagtcttttgccgcgctcaacgatatgacaacggcaggcgag
ctggcgcagcaggctggctggcagatggcggccgaaatgatcgcgctggatatcgatatc
agctttgcgccggtgctggatatcggccatatcagtgcggccataggcgatcgcgcgttc
catgaggaccctgcgattgccctggcgatggcgcggcgttttattgccggcatgcatgag
gccggaatgaaaaccaccggtaagcatttccccggtcacggcgcggtcagtgcagactcc
cacaaagagacaccgcgtgatggccgcagcgaagccgaactgcgcgagcatgatatggcg
atattccgcacgctgatcggcgagcaggcgctcgacgctattatgcccgcacacgtgatc
tatacggaagccgatccgctccccgccagcggttcaccttactggctgaaaacggtgtta
cgccaggagctgggtttcaagggcgtgattttctcggacgatctttcaatggaaggcgcg
gcggtgatgggcagctatgccgagcgtgcgcaacagtctctgtctgccggatgcgacatg
attctggtctgtaacgaccgtcagggcgcggtaagcgtgatcgataatttgaccgtgatc
gaggcagagccggtggtgcagttgtaccatcggggaacctttagccgggacagcctgaag
gccagtcgccgctggaaacagaatgcgcagcagttaagcgcgctgcaggaacgctggctg
gcgcataaagcgacgtggtaa

DBGET integrated database retrieval system