KEGG   Pantoea ananatis LMG 20103: PANA_1549Help
Entry
PANA_1549         CDS       T01195                                 

Gene name
dxs
Definition
Dxs
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA_1549 (dxs)
   01230 Biosynthesis of amino acids
    PANA_1549 (dxs)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PANA_1549 (dxs)
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    PANA_1549 (dxs)
Enzymes [BR:pam01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     PANA_1549 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1739145..1740089
Genome map
AA seq 314 aa AA seqDB search
MSKAQHLAEVMVEALMAAVDRGIDVVPVVADSTSTAKIAPFIKAFPGRLINVGIAEQALV
GTAAGLALGGKVAVTCNAAPFLISRANEQVKIDVCYNNTNVKLFGLNAGASYGPLASTHH
SIDDIAILRGFGNIEIYAPSCPLECRQIIDYALDHVGPVYIRLDGKALPQLHDDEYRFTP
GAIDLLREGHDIALVAMGSTVHEAVTAAEQLEKQGVSAAVIAVPSLRPCNTQQLHNLLSH
YRSVITVEEHNINGGVGSLVAEVLAENGLPVKLLRLGIADGEYAIAGDRASTRACHGIDA
SSVAAQALRLCTGG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaggcacaacatctggcagaggtcatggtagaagcattgatggcggcggttgat
cgcggtatcgatgtggttccggtggtggctgactccacctcaaccgctaaaatcgcgccg
tttattaaggcgtttcccggccggttaattaacgtgggcatcgccgagcaggcgctggtg
ggtacggctgccgggctggcgctgggcggaaaagtggctgtaacctgtaacgccgcaccc
tttctgatctcccgtgctaacgagcaggtgaaaatcgacgtctgttataacaatactaac
gttaagctgtttgggctgaatgcaggagccagctacggcccgctcgccagcacgcaccac
agcattgacgacatcgccatcctgcgtggatttggcaatattgaaatctacgcgccttcc
tgtccccttgagtgccgccaaatcatcgactatgcccttgatcatgtggggccggtttat
attcggctggatggcaaggcgttgccgcagttgcatgacgacgaataccgctttacacct
ggggcgatcgatctgctgcgcgaaggccatgacattgcgcttgttgccatgggctcaacg
gtacatgaggccgttaccgccgcagagcagttggaaaagcagggggtttccgccgcggta
atcgccgtgccttctcttcgtccctgtaacactcagcaattgcataatctgctgagtcac
taccgtagcgtcatcacggttgaagagcacaacatcaatggtggcgtaggcagcctggtg
gcggaggtcctggccgagaacggcttgccggttaagctgttgcgtctgggcattgcggat
ggcgagtacgccatcgccggcgatcgcgcctccacccgggcctgtcatggcattgacgcc
agcagcgtggcggcccaggcgctgcgcctttgcacaggaggctga

DBGET integrated database retrieval system