KEGG   Pantoea ananatis LMG 20103: PANA_1550Help
Entry
PANA_1550         CDS       T01195                                 

Gene name
glpK
Definition
GlpK
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PANA_1550 (glpK)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PANA_1550 (glpK)
Exosome [BR:pam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PANA_1550 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1740074..1741579
Genome map
AA seq 501 aa AA seqDB search
MHRRLTMHESVILAIDEGTTNAKAVAVNRQGKVVARASQGLTLQHPQPGLAEQAPMAIWL
AVRQAIADCLAQCADAPVAAVAISNQRESVLIWQRRDGMPLTPLVSWQDRRSESFCRDLH
LSGKDGKITALTGLAVDPMFPAAKLTGMLASLPDGVARAAAGELCIGTVDSWLTWQLSAG
ECFVTDHANAARTQLYSLHTNDWDDELLSLFSLPRAALPQITASAGCAGVVALTDIAGLA
PGTPILARIGDSHAALYAQRRDEAEVVKATYGTGSSLMMSMATPILTDNGLSTTVAWHDG
QPRFAFEGNITHTGSGAAWLGKMLGVTDPQQLTAMAESCDDNQGCYFVPALSGLGAPWWD
LKARGMLCGLTDAATPAVLARVALESITWQIADVFFAMEQASGDTLPALCVDGSATQNRW
LMQFQADVLQRPLHCAPTAEASALGAALLAGKQLGWWQQGSDMQALQGGNVVMPRRQLAQ
KMQDSYQGWLNAVARCRYQPA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
ttgcacaggaggctgacgatgcacgagtccgtgattctggctattgatgaaggcaccacc
aacgccaaagcggtcgccgtaaatcgccagggaaaagtggtggcgcgggccagtcagggc
ctgacgctgcagcatccgcaacccggtctggccgagcaggcccccatggccatctggctg
gccgtcaggcaggcgatagccgactgtcttgcccagtgcgccgacgcaccggtcgcggcg
gttgcgatcagcaatcagcgtgaatcggttttgatatggcagcgccgggacggcatgccg
ctcaccccgctggtgagctggcaggaccgccgttcggaatcgttttgccgcgatcttcat
ctgtctggaaaggacgggaagattacggcgctaaccggactggcggtcgatcctatgttt
cctgccgccaagctgaccggcatgctggcgtcactgcctgacggcgttgccagagcggcg
gcgggtgagttatgtattggcacagtggacagctggctgacctggcaactgtcggcggga
gagtgcttcgtcaccgaccatgccaatgcggcacgcacgcagctttacagtctgcacacc
aacgactgggatgatgaactgctgtccctgttcagcctgccgcgcgccgcgctgccgcag
attaccgcctcagcgggttgtgcgggcgtggttgccttaaccgatattgccggtctggca
cctggcaccccgatcctggcacgcattggcgattcccatgcggcgctttatgcccagcgc
cgtgacgaggcggaagtggtcaaggcaacctatggcacaggctcctcgctgatgatgtcg
atggcaacgccgatcctgaccgacaatggcctcagcaccaccgtggcgtggcacgacggt
caaccgcgctttgcgtttgaaggcaatattacccacaccggttcaggtgcggcctggctg
ggaaaaatgctcggcgtcaccgatccccagcagctgacggcaatggccgaaagctgtgat
gacaatcagggctgctattttgtcccggccctgtccggactgggcgcgccctggtgggat
ttaaaagcccgcggcatgctgtgcggcctgaccgatgcggccaccccggcggtgctggcg
cgggtcgcgctggagtcgattacctggcaaattgctgatgtctttttcgctatggaacag
gcaagcggcgacacattacctgcgctgtgcgttgacggcagtgcgacacaaaatcgctgg
ctgatgcagtttcaggcggacgtcctgcagcgcccgctgcattgtgcgcctaccgctgaa
gcctccgcgctgggggcggcactgctggcaggtaaacagctgggatggtggcaacagggg
agtgatatgcaggctcttcagggcggcaacgtcgtgatgccgcgcaggcagctggcgcag
aaaatgcaggacagctatcagggctggctgaacgccgttgcccgctgtcgctatcagccc
gcataa

DBGET integrated database retrieval system