KEGG   Pantoea ananatis LMG 20103: PANA_1639Help
Entry
PANA_1639         CDS       T01195                                 

Gene name
ispE
Definition
(GenBank) IspE
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00900  Terpenoid backbone biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
Module
pam_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PANA_1639 (ispE)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     PANA_1639 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C XdhC_CoxI
Motif
Other DBs
NCBI-ProteinID: ADD76806
UniProt: D4GCY3
Position
complement(1837348..1838205)
Genome map
AA seq 285 aa AA seqDB search
MMTTWPAPAKLNLFLYITGRRPDGYHNLQTLFQFLDYGDSLTITPDTSDEIRLLTPVPGV
PDAQNLIVRAAESLKSAARENGSLPARAGARIAIEKRLPMGGGLGGGSSNAATVLVALNH
LWQTGFSPEALAELGVKLGADVPVFVKGYAAFAEGVGEVLSPASPAEKWYLVAHPGVSVA
TPVVFNDPALTRDTPVRSLSALLQAPFVNDCESVVRKRFREVDELVSWLLEYAPSRLTGT
GACVFAEFDTEHAARQVLELAPPWVRGFVARGLNVSPLQRTLQGD
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccacctggcctgctccggcaaaactgaatctgtttttgtacatcaccggtcgt
cggcctgatggttaccataatctgcaaaccctgtttcagtttcttgattatggcgacagc
ctgacaatcacgcccgacacgagcgatgagatcaggctgttaacgccggtgcctggcgtg
ccggatgcgcaaaacctgattgtccgggcggcagagagcctcaagtcggcggcgcgtgaa
aacggcagcctgcctgccagggccggtgcgcgcattgccattgaaaagcgtttgcccatg
ggcggcgggctgggcggcggctcgtcgaatgccgcaaccgtgctggttgcgctaaaccac
ctgtggcagaccggcttttcccctgaggcgctggcggagctgggcgtgaaactgggcgcc
gacgtcccggtttttgttaaaggctatgccgcctttgccgaaggcgtcggtgaggtgctt
tctccagcatcgcctgcagaaaaatggtatcttgttgcccatccaggcgtcagcgtggcc
acgccggtggtcttcaacgatccggcgcttacccgtgacacgcccgtgcgcagtttatca
gcacttttacaggctccgttcgtcaacgattgcgaatcagtagtaagaaaacgttttcgt
gaggttgatgagcttgtttcatggctgctagaatacgcgccgtcgcgcctgacggggaca
ggtgcttgtgtgtttgctgaatttgacaccgagcatgctgctcgccaggtgctggaactt
gccccaccatgggtgcgcggttttgtagctcgaggccttaacgtctcgccgttacagcgt
actctgcaaggcgattag

DBGET integrated database retrieval system