KEGG   Pantoea ananatis LMG 20103: PANA_1860Help
Entry
PANA_1860         CDS       T01195                                 

Gene name
pfkA
Definition
PfkA
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PANA_1860 (pfkA)
   01230 Biosynthesis of amino acids
    PANA_1860 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA_1860 (pfkA)
   00030 Pentose phosphate pathway
    PANA_1860 (pfkA)
   00051 Fructose and mannose metabolism
    PANA_1860 (pfkA)
   00052 Galactose metabolism
    PANA_1860 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PANA_1860 (pfkA)
Enzymes [BR:pam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PANA_1860 (pfkA)
Protein phosphatases and associated proteins [BR:pam01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PANA_1860 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2081772..2082680
Genome map
AA seq 302 aa AA seqDB search
MTQAEMILFNGGIPGLLDNVCQEISQRDLVDFSITSLPVMQSGRTARKLIRSEYETIARQ
LKALRIDVLILAGGDGSLQFLHTLSEFGVNCFGIGMTIDNDVYGSDYTVGFSTACEQVLK
EVAKLRNTGRALTGRVFMVELLGGYCGELTLQSALKSNADFALIPECQIPTNVLAERITQ
RLSEQNSVVILCSEGYTREYSPGFQGAIDTLIKQLEPLIGVRIRKTIVGYGLRNGDPTCE
EIYQGTIMASEVVRCIQSGMRNKAVIINGSNKPIPIDLISMKKRLVDTEGHHYKLAKQLH
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggcggagatgatattatttaacggtggcattccaggcttgctggataatgtc
tgccaggaaatttctcagcgcgatttagtggatttttccattacttctcttccggtaatg
cagtcaggccgaaccgcgcgaaaattaattcgtagcgaatatgaaacgatcgcccggcag
ttaaaagcattacgcatcgacgtattaattctggctggaggcgatggatcgctgcaattt
ctgcatacgctcagtgaatttggtgtgaactgttttggcatcggcatgacgattgacaac
gatgtctacggcagtgattacaccgtgggcttttccaccgcctgtgagcaggtattaaaa
gaggtggcaaagctcagaaacaccggtcgggcattaacgggccgggtatttatggtggaa
ctgctcggcggctactgtggcgaattgacgctccagtcagcgctcaaatccaacgccgac
tttgcgctgatcccggaatgccagatccccacaaacgtgctggcagaacgcatcactcag
cgcctcagcgaacaaaacagcgtggtaatcctctgctcagaaggttacacacgggaatat
tcaccgggctttcagggggcgattgacacattaattaagcagcttgaaccgttgatcggc
gtgcgcattcgcaaaacgatcgtcggctatggactgcgaaatggcgatcccacctgtgag
gaaatttatcagggcaccattatggcaagtgaagtggttcgttgtattcaatccggaatg
cgcaataaagccgtgattattaacggcagtaataagcctattccgattgacttaataagc
atgaaaaaacgcctggtcgatacagaagggcatcattataaactcgctaaacaactgcat
atattgtga

DBGET integrated database retrieval system