KEGG   Pantoea ananatis LMG 20103: PANA_1872Help
Entry
PANA_1872         CDS       T01195                                 

Gene name
xylA
Definition
XylA
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PANA_1872 (xylA)
   00051 Fructose and mannose metabolism
    PANA_1872 (xylA)
Enzymes [BR:pam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     PANA_1872 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2091958..2092947
Genome map
AA seq 329 aa AA seqDB search
MSLMSDLKFATRLNSFASGAHLYWPDLQGKPSVLQMVARAGKVKGLTHLDLNYPQHLTSD
SKTLRQAIEDAGLAVNGMQMRWDAPQFKIGAFTHPDPKIRREAIDLTKRGIDTGREFGSR
LMTLWMGQDGFDYCFQVDYKKIWEDAVSAVREIADYAPDVDVSIEYKPNEPRAYSIFPNV
TTCLLAVEEAGSPNLGITLDFAHVLFANEIPAWAAAMVARRSRLLGLDLNDGWGKRDDGL
MAASVNPRATLEFLWQMQRDGYQGAYYFDTFPDASGLDPVREAETNIATVTRLLKLCDQL
NDNPALAAAISRQDAVASQQIVNDIMLAR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
ttgagcctcatgtcagatttaaagtttgctactcgtcttaactcctttgcttcgggggca
catctctactggccagatttgcagggcaagccctctgtactgcaaatggtggcgcgcgcg
ggcaaggttaaaggcttaacgcatttggatctcaactatccccagcacctcaccagtgac
agtaaaacgctgcgccaggctattgaggatgccgggctggcggtcaacggcatgcagatg
cggtgggatgcaccgcagttcaaaattggcgcatttacccatccggatccaaaaattcgc
cgtgaggcgattgacctgaccaagcggggaatcgataccggacgggaatttggctcccgc
ttaatgacgttatggatgggtcaggacggtttcgactactgcttccaggtcgattacaaa
aaaatctgggaagacgccgtcagcgcggtacgtgaaatcgccgactacgcgccggacgtg
gatgtgagcattgaatacaaacccaacgagccgcgtgcctacagcatttttcccaacgtg
accacctgcctgctggccgtcgaagaggccggaagcccgaatctcggcatcacgctggat
ttcgcccatgtcctgttcgccaatgaaattcctgcctgggcggcggccatggtggcgcgt
cgttcccggctgctggggctggatttaaacgacggctggggcaaacgtgacgacggactg
atggcggcatcggttaatccgcgcgccacgttggagtttctgtggcagatgcagcgtgat
ggttatcagggcgcctactattttgacaccttcccggatgccagcggactggatccggta
cgtgaagccgaaaccaacattgccaccgtgacgcgattactcaaactttgcgaccagctt
aatgataatccggcgctggcagcggcgatcagccgtcaggatgcggtcgcctcacagcaa
atcgtcaacgacattatgctggcgcgttaa

DBGET integrated database retrieval system