KEGG   Pantoea ananatis LMG 20103: PANA_2068Help
Entry
PANA_2068         CDS       T01195                                 

Gene name
trpC
Definition
TrpC
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pam01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pam00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2315453..2316814
Genome map
AA seq 453 aa AA seqDB search
MQGTVLDKIVKDKAVWVEARKQQQPLESFQQRVALSSRSFYDALQGTRTAFILECKKASP
SKGLIRDDFDPEMIAGVYRHYASAVSVLTDEKYFQGDFAFLPVVSAAITQPVLCKDFIID
PYQIYLARYYQADAILLMLSVVDDEQYRQLAAIAHSLQMGVLTEVSNEQELERAIALEAK
VVGINNRDLRDLSIDLNRTRELAPRLGPGVTVISESGINNYRDVRELSHFANGFLIGSAL
MEEEDLHAAVRRVTLGSNKVCGLTRPEDACAACEAGAIFGGLIFVEGSPRQVDTERARAV
MAGAPLKYVGVFRDAAISDIVTKTEALQLSAVQLHGDEDPDYVAELYQALPENVQIWKAL
SIQTALPERRWPHVDRYVFDNGNGGSGQTFDWSLLKGQDLKNVLLAGGLSADNCVEAAQL
GCAGLDFNSGVESEPGIKDASKIASVFRTLRAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcagggtacagtgttagataaaatcgtgaaagacaaagccgtttgggttgaggcgcgt
aagcagcagcaacctctggagagtttccagcagcgagtggcgctttccagccgtagtttt
tatgacgcactgcagggcacccgcactgcctttattctggaatgcaaaaaagcctctcca
tccaaagggcttattcgtgatgattttgatcctgagatgatagccggggtttatcgccac
tatgcctctgccgtttccgtattaacggacgagaaatactttcagggtgacttcgccttt
ttgcccgtcgtcagcgcggccattacgcagccggtcctgtgcaaagattttattatcgat
ccgtatcaaatttacctggcgcgttactaccaggcggatgccatcctgctgatgctctct
gtggttgacgacgagcagtatcgccagctggccgccattgcgcacagcctgcagatgggc
gtcctgactgaagtcagtaacgagcaggagctggaacgcgcgattgcgctggaagccaaa
gtggtcggcatcaacaaccgtgacttacgcgatctctccatcgaccttaaccggacccgt
gaactggccccgcgcctgggccccggcgtcaccgtgatcagcgagtcgggcatcaacaac
tatcgggatgtccgcgagttaagccattttgcgaatggtttcctcatcggctctgcgcta
atggaagaagaggatcttcatgccgccgtgcgccgcgtcaccctgggcagcaataaagtc
tgcggtctgacccgtcctgaagacgcctgcgcggcctgcgaggcaggtgccatttttggt
ggtttgatctttgttgaaggttcgccgcgtcaggttgataccgagcgcgcgcgcgcggtc
atggctggcgcaccgctaaagtatgttggcgtgttccgtgatgccgctataagtgacatt
gtcaccaaaacagaggcgttacagctgagtgccgtgcaactgcatggcgatgaagacccg
gactatgtggctgagctttatcaggcgctgccagaaaacgtgcaaatctggaaagcgctc
agcatccagacggccctgcccgaacgtcgctggccccatgttgaccgctatgtcttcgat
aacggcaacggtggctcgggccagacatttgactggtcgctgctaaaaggacaggacctg
aagaatgttctgctggcaggaggactgagcgctgacaactgcgtcgaagccgctcagtta
ggctgtgcagggctggatttcaattcgggcgtggaaagcgagccgggtattaaagacgcc
agcaaaattgcctcggtattccggacgcttcgcgcctactga

DBGET integrated database retrieval system