KEGG   Pantoea ananatis LMG 20103: PANA_2069Help
Entry
PANA_2069         CDS       T01195                                 

Gene name
trpB
Definition
TrpB
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PANA_2069 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_2069 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_2069 (trpB)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PANA_2069 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2316862..2318052
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGDFGGMYVPQILMPALKQLEEAFVSAQKDPEFQAEFTDLLKNYAGRPTALTL
CSNLTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPFPTIVREFQRMIGEETKKQILEKEGRLPDAVIACVGGGSNAIGMF
ADFIDEEKVKLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTDEGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRADYVSVTDNEALAAFKTLCRAEGIIPALESAHALAHALRM
IKAEPEKEQLIVVNLSGRGDKDIFTVHDILTAQGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacttaatccctattttggcgacttcggcggcatgtatgtgccgcagattttg
atgccggccttgaaacagctagaagaagcttttgtcagcgcgcaaaaagatccggaattc
caggctgaatttaccgatctgctgaaaaattatgctggccgccccacagccttaaccctg
tgcagtaatctgaccaaagggtcgaaaacccgcctgtacttaaagcgcgaagacctgttg
cacggcggcgcgcacaagaccaaccaggtgttagggcaggctctgctggctaagcgcatg
ggcaaaaacgaaatcattgccgaaaccggtgcaggccagcatggcgtcgcctctgccctt
gcctgcgcgctgctgggcatgaaatgtcgcatctatatgggcgccaaagacgtagagcgg
cagtcgccgaacgtctttcgtatgcgcctgatgggcgccgaggtcatcccggtgcacagc
ggctctgccacgctgaaagatgcctgcaacgaagcgctgcgcgactggtcaggcagttat
gaaaccgctcactatatgctgggcactgcggcgggtccgcacccgttcccgacgattgtg
cgtgagtttcagcgcatgattggtgaagagaccaaaaagcagattctggaaaaggaaggt
cgcctgccggatgccgtgatcgcctgcgtcggcgggggctccaatgccatcggtatgttt
gccgactttatcgacgaagagaaggtgaagctgattggtgttgaaccggccggacacggg
attgaaaccggcgaacacggtgcaccactgaagcacggccgcgtcggcatttacttcggt
atgaaagccccgatgatgcagactgacgaagggcagattgaagagtcatactcaatttca
gccggactcgactttccttccgtcggtcctcagcacgctcacctcaacagtattggtcgg
gctgactatgtttcggtaaccgacaatgaagcgcttgctgcctttaaaacgctgtgccgc
gccgaaggtatcattcctgccctggagtcggcgcacgcgctggcccacgcgctgagaatg
attaaggcagaacccgagaaagagcagttgattgtcgtcaacctttcgggtcgcggtgat
aaagatatcttcaccgtccacgatattctgactgcgcagggagaaatctga

DBGET integrated database retrieval system