KEGG   Pantoea ananatis LMG 20103: PANA_2069Help
Entry
PANA_2069         CDS       T01195                                 

Gene name
trpB
Definition
(GenBank) TrpB
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00260  Glycine, serine and threonine metabolism
pam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pam01100  Metabolic pathways
pam01110  Biosynthesis of secondary metabolites
pam01130  Biosynthesis of antibiotics
pam01230  Biosynthesis of amino acids
Module
pam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_2069 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_2069 (trpB)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PANA_2069 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADD77236
UniProt: D4GFB4
Position
2316862..2318052
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGDFGGMYVPQILMPALKQLEEAFVSAQKDPEFQAEFTDLLKNYAGRPTALTL
CSNLTKGSKTRLYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGMKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETAHYMLGTAAGPHPFPTIVREFQRMIGEETKKQILEKEGRLPDAVIACVGGGSNAIGMF
ADFIDEEKVKLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTDEGQIEESYSIS
AGLDFPSVGPQHAHLNSIGRADYVSVTDNEALAAFKTLCRAEGIIPALESAHALAHALRM
IKAEPEKEQLIVVNLSGRGDKDIFTVHDILTAQGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccttacttaatccctattttggcgacttcggcggcatgtatgtgccgcagattttg
atgccggccttgaaacagctagaagaagcttttgtcagcgcgcaaaaagatccggaattc
caggctgaatttaccgatctgctgaaaaattatgctggccgccccacagccttaaccctg
tgcagtaatctgaccaaagggtcgaaaacccgcctgtacttaaagcgcgaagacctgttg
cacggcggcgcgcacaagaccaaccaggtgttagggcaggctctgctggctaagcgcatg
ggcaaaaacgaaatcattgccgaaaccggtgcaggccagcatggcgtcgcctctgccctt
gcctgcgcgctgctgggcatgaaatgtcgcatctatatgggcgccaaagacgtagagcgg
cagtcgccgaacgtctttcgtatgcgcctgatgggcgccgaggtcatcccggtgcacagc
ggctctgccacgctgaaagatgcctgcaacgaagcgctgcgcgactggtcaggcagttat
gaaaccgctcactatatgctgggcactgcggcgggtccgcacccgttcccgacgattgtg
cgtgagtttcagcgcatgattggtgaagagaccaaaaagcagattctggaaaaggaaggt
cgcctgccggatgccgtgatcgcctgcgtcggcgggggctccaatgccatcggtatgttt
gccgactttatcgacgaagagaaggtgaagctgattggtgttgaaccggccggacacggg
attgaaaccggcgaacacggtgcaccactgaagcacggccgcgtcggcatttacttcggt
atgaaagccccgatgatgcagactgacgaagggcagattgaagagtcatactcaatttca
gccggactcgactttccttccgtcggtcctcagcacgctcacctcaacagtattggtcgg
gctgactatgtttcggtaaccgacaatgaagcgcttgctgcctttaaaacgctgtgccgc
gccgaaggtatcattcctgccctggagtcggcgcacgcgctggcccacgcgctgagaatg
attaaggcagaacccgagaaagagcagttgattgtcgtcaacctttcgggtcgcggtgat
aaagatatcttcaccgtccacgatattctgactgcgcagggagaaatctga

DBGET integrated database retrieval system