KEGG   Pantoea ananatis LMG 20103: PANA_2070Help
Entry
PANA_2070         CDS       T01195                                 

Gene name
trpA
Definition
TrpA
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PANA_2070 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PANA_2070 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PANA_2070 (trpA)
Enzymes [BR:pam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PANA_2070 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2318052..2318855
Genome map
AA seq 267 aa AA seqDB search
MERYDRLFSRLAEKKEGALVPFVTLGDPSPEMSLRIIDALVEGGADALELGIPFSDPLAD
GPTIQSATLRAFAAGTTTAQCFEMLAAIRHKYPELPVGLLMYANLVFSNGIDEFYARCAQ
AGVDSVLVADVPVEESAPFRQAAMRHGIAPIFICPPNASDELLREIASHGRGYTYLLSRA
GVTGTEKRASLPLDHLITKLREYHAAPPLQGFGISEPSQVRESLGAGSAGAISGSAVVKI
IEQHQAEPEVMLDALRTFIGNLKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgatcgactgttttcacgtctggcagagaagaaagaaggtgcactggtg
cctttcgttacgctgggcgatccgtcacccgaaatgtcattacgaattattgatgcgctg
gtagaaggtggtgcagatgcgcttgaactgggtattcccttttcagatccgctagcggat
ggtccgacaattcaaagcgcaacgctgcgcgcctttgctgcgggcaccaccacagcacag
tgctttgaaatgcttgctgccatccgtcataagtaccctgaattacctgttggcttactc
atgtacgccaaccttgtgttcagcaacggcattgatgaattttatgcccgctgtgcccag
gccggggttgattcggttctcgtggcagatgtgcccgtggaagaatccgcgccgttccgt
caggccgctatgcgtcacgggattgcgcccattttcatttgcccccccaacgccagcgat
gaactactccgtgaaattgcctctcacggccgcggttatacctatctgttgtcacgcgct
ggggtgaccggtaccgagaagcgggccagcctgccgctggaccacctgattacaaaatta
cgggaatatcatgcagcgccgccgctgcagggctttggcatttctgaaccctcgcaggtt
agagaatctctcggtgcgggctccgccggtgcgatctcaggttcggccgtggttaaaatc
attgaacaacatcaggcagaacccgaagtgatgctggatgccctgagaacctttattggt
aacctcaaagccgccacccgctaa

DBGET integrated database retrieval system